SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011022 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011022
Domain Number 1 Region: 610-916
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.07e-115
Family PDEase 0.0000000788
Further Details:      
 
Domain Number 2 Region: 199-398
Classification Level Classification E-value
Superfamily GAF domain-like 6.54e-47
Family GAF domain 0.0001
Further Details:      
 
Domain Number 3 Region: 382-579
Classification Level Classification E-value
Superfamily GAF domain-like 7.2e-41
Family GAF domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011022   Gene: ENSPANG00000025222   Transcript: ENSPANT00000005477
Sequence length 935
Comment pep:known_by_projection chromosome:PapAnu2.0:12:39532534:39983767:-1 gene:ENSPANG00000025222 transcript:ENSPANT00000005477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRLDFGEVETFLDRHPELFEDYLMRKGKQEMVEKWLQRHSQGQGALGPRPSLAGTSS
LAHSTCKGGSSIGGGIGPNGSAHSQPLPSGGDCGGVPLSPSWASGSRGDGNLQRRASQKE
LRKSFARSKAIHVNRTYDEQATSRAQEPLSSVRRRALLRKASSLPPTTAHILSALLESRV
NLPQYPPTAIDYKCHLKKHNERQFFLELVKDISNDLDLTSLSYKILIFVCLMVDADRCSL
FLVERAAAGKKTLVSKFFDVHAGTPLLPCSSTENSNEVQVPWGKGIIGYVGEHGETVNIP
DAYQDRRFNDEIDKLTGYKTKSLLCMPIRSSDGEIIGVAQAINKIPEGAPFTEDDEKVMQ
MYLPFCGIAISNAQLFAASRKEYERSRAFLEVVNDLFEEQTDLEKIVKKIMHRAQTLLKC
ERCSVLLLEDIESPVVKFTKSFELLSPKCSADAENSFKESMEKSSYSDWLINNSIAELVA
STGLPVNISDAYQDPRFDAEADQISGFHIRSVLCVPIWNSNHQIIGVAQVLNRLDGKPFD
DADQRLFEAFVIFCGLGINNTIMYDQVKKSWAKQSVALDNQVLSYHATCSKAEVDKFKAA
NIPLVSELAIDDIHFDDFSLDVDAMITAALRMFMELGMVQKFKIDYETLCRWLLTVRKNY
RMVLYHNWRHAFNVCQLMFAMLTTAGFQEILTEVEILAVIVGCLCHDLDHRGTNNAFQAK
SGSALAQLYGTSATLEHHHFNHAVMILQSEGHNIFANLSSKEYSDLMQLLKQSILATDLT
LYFERRTEFFELVSKGEYDWNIKNHRDVFRSMLMTACDLGAVTKPWEISRQVAELVTSEF
FEQGDRERLELKLTPSAIFDRNRKDELPRLQLEWIDSICMPLYQALVKVNVKLKPMLDSV
AANRSKWEELHQKRLLASTASSSPASVMVATEDRN
Download sequence
Identical sequences ENSPANP00000011022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]