SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011048 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000011048
Domain Number - Region: 104-248
Classification Level Classification E-value
Superfamily TPR-like 0.00164
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Domain Number - Region: 24-74
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0647
Family Spectrin repeat 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011048   Gene: ENSPANG00000023466   Transcript: ENSPANT00000000374
Sequence length 308
Comment pep:known_by_projection chromosome:PapAnu2.0:11:112353307:112361943:1 gene:ENSPANG00000023466 transcript:ENSPANT00000000374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVPWEEYFRLALQEKLSTKLPEQAEDYVPPVLRLLEKRQELVDADQALQAQKEVFRTRM
AALKQRWEQLEQKERELKGSFIRFDKFLQDSEARRNRALRRAAEERHQASRREAEALRLR
TQLEELRQERARLQRRLKRLEPCARLLEQALELLPGFQEVPELVARFDGLAQTQAALRLR
ERERLAELEAARSRLQQLRDAWPDEVLAQGQRRAQLQERLEAARELTLQWESKWIQIQNT
AAEKTLLLGRSRMAVLNLFQLVCQHQRQPPTLDIEDTEGQLEQVKLFMQDLSAMLAGLGQ
AEPAAPAS
Download sequence
Identical sequences A0A096NDU8
ENSPANP00000011048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]