SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011056 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011056
Domain Number 1 Region: 44-116
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.35e-21
Family Cold shock DNA-binding domain-like 0.00000879
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011056   Gene: ENSPANG00000013156   Transcript: ENSPANT00000025917
Sequence length 313
Comment pep:known_by_projection chromosome:PapAnu2.0:1:44831677:44850838:1 gene:ENSPANG00000013156 transcript:ENSPANT00000025917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEAETQLSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRNG
YGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGV
PVQGSKYAADRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRR
RFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPR
QRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAE
NSSAPEAEQGGAE
Download sequence
Identical sequences ENSPANP00000010918 ENSPANP00000011056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]