SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011073 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011073
Domain Number 1 Region: 498-829
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 6.28e-93
Family PDEase 0.000000837
Further Details:      
 
Domain Number 2 Region: 52-249
Classification Level Classification E-value
Superfamily GAF domain-like 3.49e-36
Family GAF domain 0.00025
Further Details:      
 
Domain Number 3 Region: 236-280,307-456
Classification Level Classification E-value
Superfamily GAF domain-like 8.24e-31
Family GAF domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011073   Gene: ENSPANG00000019722   Transcript: ENSPANT00000009624
Sequence length 857
Comment pep:known_by_projection chromosome:PapAnu2.0:1:3421979:3464037:-1 gene:ENSPANG00000019722 transcript:ENSPANT00000009624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSEEQARSFLDQNPDFARQYFGKKLSPENVAAACEDRCPPDCNSFRELCQVEESEALL
ELVQDMQESINMERVVFKVLRRLCTLLQADRCSLFMYRQRNGVAELATRLFSVQPDSVLE
DCLVPPDSEIVFPLDIGVVGHVAQTKKMVNVKDVAEQCPHFSSFADELTDYKTKNILATP
IMNGKDVVAVIMAVNKLNGPFFTSEDEDVFLKYLNFATLDLKIYHLSYLHNCETRRGQVL
LWSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWPVLMGESQP
YSGPRTPDGREIVFYKVIDYILHGKEEIKVIPTPPADHWALASGLPSYVAESGFICNIMN
ASADEMFTFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLME
SLTQFLGWSVMNTDTHDKMNKLENRKDIAQDMVLYHVKCDRDEIQLILPTRARLGKEPAD
CDEDELGEILKEELPGPATSDIYEFHFSDLECTELDLVKCGIQMYYELGVVRKFQIPQED
LIIRHIIRQSQGIWCGVLRKWRHPVTLAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHD
IDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLSEETLNIYQNLNRRQHEHVIH
LMDIAIIATDLALYFKKRAMFQKIVDESKNYEDKKSWVEYLSLETTRKEIVMAMMMTACD
LSAITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAAELPKLQVGFIDFV
CTFVYKEFSRFHEEILPMFDRLQNNRKEWKALADEYEAKVKALEEEKKEEERVALKKVGT
EICNGGPAPKSSTCCIL
Download sequence
Identical sequences ENSPANP00000011073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]