SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011077 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011077
Domain Number 1 Region: 284-366
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.16e-19
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.091
Further Details:      
 
Domain Number 2 Region: 87-212
Classification Level Classification E-value
Superfamily TPR-like 0.0000284
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011077   Gene: ENSPANG00000014295   Transcript: ENSPANT00000006168
Sequence length 389
Comment pep:known_by_projection chromosome:PapAnu2.0:2:71275371:71287815:1 gene:ENSPANG00000014295 transcript:ENSPANT00000006168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLENLEEEGLPKNPDLRIAQLRFLLSLPEHRGDAAVRDELMAAVRDNNMAPYYEALCRS
LDWQIDVDLLNKMKKANEDELKRLDEELEDAEKNLGESEIRDAMMAKAEYLCRIGDKEGA
LTAFRKTYDKTVALGHRLDIVFYLLRIGLFYMDNDLITRNTEKAKSLIEEGGDWDRRNRL
KVYQGLYCVAIRDFKQAAELFLDTVSTFTSYELMDYKTFVTYTVYVSMIALERPDLREKV
IKGAEILEVLHSLPAVRQYLFSLYECRYSVFFQSLAVVEQEMKKDWLFAPHYRYYVREMR
IHAYSQLLESYRSLTLGYMAEAFGVGVEFIDQELSRFIAAGRLHCKIDKVNEIVETNRPD
SKNWQYQETIKKGDLLLNRVQKLSRVINM
Download sequence
Identical sequences A0A096NDX7 A0A2K5HMN5 A0A2K5LGI5 A0A2K6AIY1 A0A2K6B7R7 A0A2K6LH53 A0A2K6RAZ9 F7GFM2 G7NZA4
9544.ENSMMUP00000002009 ENSMMUP00000002009 ENSMMUP00000002009 ENSPANP00000011077 NP_001253686.1.72884 XP_010351198.1.97406 XP_011742409.1.29376 XP_011915143.1.92194 XP_017730503.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]