SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011099 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011099
Domain Number 1 Region: 3-95
Classification Level Classification E-value
Superfamily EF-hand 2.38e-17
Family S100 proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011099   Gene: ENSPANG00000010864   Transcript: ENSPANT00000019462
Sequence length 1642
Comment pep:known_by_projection chromosome:PapAnu2.0:1:126073240:126082174:-1 gene:ENSPANG00000010864 transcript:ENSPANT00000019462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKLLQGIITVIDVFYQYATQHGEYDMLNKAEMKELLENEFHQILKNPNDPDTVDIILQN
LDRDHNKKVDFTEYLLMIFKLVRAHNKIISKDYCQASGSKLRDNSHQHQEEQEETGKEDK
WQESSSSHSSWSAGENDSHSRNVRGSITHGPESISRRLSFQRDFSGQNKSSSGQSSRYGQ
HESGSHQSPGHGQRGSHSGQSPTYGQLGSGYKRSSSSGPHGSGSRQSSAFGQHESTSGQS
SGHNQHGSGSGHSFSHGQHGSTSGQSSSFGQEGTSAGQSSRYDHHDSGSSQSPGYGRHGA
GSGQSPSRGLHGAGSGLSSNCGPQESGSAQSSDFGQYESSSGQSSSYSQHGSGSGHSSGY
GQHESRSGQSPRGEQHGSSSGSSSTYGRHGSGFHQSSGHRRNRSGSSQSPTPSRGRHGSG
SGQSSSRGPYESASGHSSGLGQHESHSGQSSGYGQHGSSSGHSFTHGQHGTTPGQSSSCG
QHGASSGQSSNHGQHGSGSSQSSGYGRQGSGSGQSPSRGRHGSSSGLSSNYDQHGSGSGR
SSSQSSGYGRQGSGSGQSPSRGRHGSSSGHFSSYGQHGSGSGRSSSRGPYESGSGHSSGF
GQHESGSGQSSGYSQHGSGSGHSSSHGQHGSTSRHSLSFGQEGSSTGQSSSYSHQSSGYS
QSSGYGRHGAGSGQSPSRGRHGSGSGQSSSYGQHGSGSGQSSSYSQHGSGSGHASSHGKH
GSTSGQSSSFGQKGSSSGQSSSYGQHGSGSHQSSGHGRHGSGSGRSPSQGRNGSSSGHYP
GHGQQGSGSGCSSSRGRYESGSGQSSGFGQHESGSAQSSGYSQHGSGSGHSSSQGRHGST
SGHSSSSGQHGSSSGQSSSYGQHESGSHQYSGRGRHGSGSGQSKGRGRRGSGSGHSPSYG
QHGSGSGRSSSQSSGYGRQGSGSGQSPSRGRHGSGSGHSSSYGQHGSGSGRSSSHGSYES
GSGHSSGLGQHESRSGQSSGYGQQGSSSGHSFTHEQHGSTSGQSSSCGQHGASSGQSSSH
GQHGSGSSQSSGYGRQGSGSGQSPSRGRHGSGSRHSSSYGQHGSGAGGSSSHSSGYGRQG
SGSGQSPSRGRHGSGSGHSSSYGQHGSGSGRSSSRRPIGSGSGHSSSHGQHGSTSRHSLS
FGQEGSSTGQSSSYSHQSSGYSQSSGYGRHGAGSGQSPSRGRHGSGSEQSSSYGQHGSGS
GQSSGYSQHGSGSGHASSHGQHGSTSGQSSSFGQKGSSSGQSSSYGQHGSGSHQSSGHGR
HGSGSGRSPSQGRNGSSSGHYPGHSQQGSGSGCSSSRGRYESGSGQSSGFGQHESGSAQS
SGYSQHGSGSGHSSSQGRHGSTSGHRQSSSSGQHGSSSGQSSSYGQHESGSHQYSGRGRH
GSGSGQSKGRGQRGSGSGQSPSYGQHGSGSGRSSSQSSGYGRQGSGSGQSPSRGRHGSGS
RHSSSYSQHGSGSGRSSSHGSYESGSGHSSGLGQHESRSGQSSGYGQQGSSSGHSFTHEQ
HGSTSGQSSSCGQHGASSGQSSSHGQHGSGSSQSSGYGRQGSGSGQSPSRGRHGSGSGHS
SSYGQHGSGSGRSLRQSSGYGRQGSGSGQSPSRGRHGSGSGHSSSYGQHESGSDSPLDTV
SMEVAQGTPLAMDSMVLHHDTH
Download sequence
Identical sequences ENSPANP00000011099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]