SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011104 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011104
Domain Number 1 Region: 1-164
Classification Level Classification E-value
Superfamily Cyclophilin-like 1.31e-79
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000235
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011104   Gene: ENSPANG00000007547   Transcript: ENSPANT00000019795
Sequence length 165
Comment pep:novel chromosome:PapAnu2.0:2:48534961:48535675:1 gene:ENSPANG00000007547 transcript:ENSPANT00000019795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFLALSTGEKGFGYKGSCFHRIIPGF
MCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTE
WLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE
Download sequence
Identical sequences ENSPANP00000011104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]