SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011115 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011115
Domain Number 1 Region: 16-165,194-334
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.14e-71
Family WD40-repeat 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011115
Domain Number - Region: 449-584
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.000306
Family YVTN repeat 0.048
Further Details:      
 
Domain Number - Region: 997-1041,1082-1158
Classification Level Classification E-value
Superfamily TPR-like 0.0123
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011115   Gene: ENSPANG00000005347   Transcript: ENSPANT00000019124
Sequence length 1225
Comment pep:known_by_projection chromosome:PapAnu2.0:1:134191689:134246412:-1 gene:ENSPANG00000005347 transcript:ENSPANT00000019124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTKFETKSARVKGRLSFHPKRPWILTSLHNGVIQLWDYRMCTLIDKFDEHDGPVRGIDF
HKQQPLFVSGGDDYKIKVWNYKLRRCLFTLLGHLDYIRTTFFHHEYPWILSASDDQTIRV
WNWQSRTCVCVLTGHNHYVMCAQFHPSEDLVVSASLDQTVRVWDISVLREQKLSPGAVES
DVRGITGVDLFGTTDAVVKHVLEGHDRGVNWAAFHPTMPLIVSGADDRQVKIWRMNESKA
WEVDTCRGHYNNVSCAVFHPRQELILSNSEDKSIRVWDMSKRTGVQTFRRDHDRFWVLAA
HPNLNLFAAGHDGGMIVFKLERERPAYAVHGNMLHYVKDRFLRQLDFNSSKDVAVMQLRS
GSKFPVFNMSYNPAENAVLLCTRASNLENSTYDLYTIPKDADSQNPDAPEGKRSSGLTAV
WVARNRFAVLDRMHSLLIKNLKNEITKKVQVPNCDEIFYAGTGNLLLRDADSITLFDVQQ
KRTLASVKISKVKYVIWSADMSHVALLAKHAIVICNRKLDALCNIHENIRVKSGAWDESG
VFIYTTSNHIKYAVTTGDHGIIRTLDLPIYVTRVKGNNVYCLDRECRPRVLTIDPTEFKF
KLALINRKYDEVLHMVRNAKLVGQSIIAYLQKKGYPEVALHFVKDEKTRFSLALECGNIE
IALEAAKALDDKNCWEKLGEVALLQGNHQIVEMCYQRTKNFDKLSFLYLITGNLEKLRKM
MKIAEIRKDMSGHYQNALYLGDVSERVRILKNCGQKSLAYLTAATHGLDEEAESLKETFD
PEKETIPDIDPNAKLLQPPAPIMPLDTNWPLLTVSKGFFEGTIASKGKGGALAADIDIDT
VGTEGWGEDAELQLDEDGFVEATEGLGDDALGKGQEEGGGWDVEEDLELPPELDISPGAS
GGAEDGFFVPPTKGTSPTQIWCNNSQLPVDHILAGSFETAMRLLHDQVGVIQFGPYKQLF
LQTYARGRTTYQALPCLPSMYGYPNRNWKDAGLKNGVPAVGLKLNDLIQRLQLCYQLTTV
GKFEEAVEKFRSILLSVPLLVVDNKQEIAEAQQLITICREYIVGLSMEIERKKLPKETLE
QQKRICEMAAYFTHSNLQPVHMILVLRTALNLFFKLKNFKTAATFARRLLELGPKPEVAQ
QTRKILSACEKNPADAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEFKGQ
ICRVTTVTEIGKDVIGLRISPLQFR
Download sequence
Identical sequences ENSPANP00000011115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]