SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011118 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011118
Domain Number 1 Region: 517-636
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-31
Family Ankyrin repeat 0.0004
Further Details:      
 
Domain Number 2 Region: 1042-1336
Classification Level Classification E-value
Superfamily RNI-like 3.14e-31
Family Rna1p (RanGAP1), N-terminal domain 0.074
Further Details:      
 
Domain Number 3 Region: 134-304
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000948
Family Tetratricopeptide repeat (TPR) 0.035
Further Details:      
 
Domain Number 4 Region: 307-434
Classification Level Classification E-value
Superfamily TPR-like 0.000000000558
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 
Domain Number 5 Region: 10-140
Classification Level Classification E-value
Superfamily TPR-like 0.000000185
Family Tetratricopeptide repeat (TPR) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011118   Gene: ENSPANG00000015002   Transcript: ENSPANT00000017593
Sequence length 1373
Comment pep:known_by_projection chromosome:PapAnu2.0:8:138997808:139013129:-1 gene:ENSPANG00000015002 transcript:ENSPANT00000017593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLERELRQLSKAKAKAQRAGQRREEAALCHQLGELLAGHGRYAEALEQHWQELRLRESA
DDPLGCAVAHRKIGERLAEMEDYPTALQTQHQHHYLELAHSLRNHTELQRAWATIGRTHL
DIYDHCQSRDALLQAQAAFEKSLAIVDEELEGTLAQGELNEMRTRLYLNLGLTFESLQQT
ALCNDYFRKSIFLAEQNHLYEDLFRARYNLGTVHWRAGQHSQAMRCLEGARECAHTMRKR
FMESECCVAIAQVLQDLGDFLAAKRALKKAYRLGSQKPVQRAAVCQNLQHVLAVVRLQQQ
LEDAEGSDLQGAMAICEQLGDLFSKAGDFPRAAEAYQKQLRFAELLDRPGAERAIIHVSL
AATLGDMKDHRGAVRHYEEELRLRSGNMLEEAKTWLNIALSREEAGDAYELLAPCFQKAL
SCAQQAQRPQLQRQVLQHLHTVQLRLQPQDAPGTETRLQELSVDEDEDEEEEAAATAECK
ALEASEVELSESEDDADGLTPQLEEDEELQGRPGRRKGSKWNRRNDMGETLLHRACIEGQ
LRRVQDLVRQGHPLNPRDYCGWTPLHEACNYGHLEIVRFLLDHGAAVDDPGGQGCEGITP
LHDALNCGHFEVAELLLERGASVTLRTRKGLSPLETLQQWVKLYRRDLDLETRQKARAME
MLLQAAASGQDPHSSQDSLTIPSSLLFDPETSPPLSPCPKPPSNSTRPPEASQARARVSP
GQAAPAVARPRRSRHGPASSSSSEGEDSAGPPRLSQKRPRCLGTAQQVAARTPGLASNRE
AAAASNSRAAYQAAIRGVGSAQSRLGPHPPRGQSKALAPPAALIPEEECLAGDWLELDTP
LTRSRRPRPQGTGDSRRPSSTSGSDSEESRPRARAKQVRLTCVQSCSAPVKAGPSSLSSE
PPGSPSTARVSEPSGDSSAAGQPLGLAMPPPIRVRVQVQDHLFLIPVPHSSETHSVAWLA
EQAAQRYYQTCGLLPRLTLRKEGALLAPQDPIPDVLQSNDEVLAEVTSWDLPPLTDRYRR
ACQSLGQGEHQQVLQAVEVQGSGLSFSACSLALHQAQLTPLLRALKLHTALRELHLAGNR
LGDKCVAELVAALGTMPSLALLDLSSNHLGPEGLRQLAMGLPGQATLQSLEELDLSMNPL
GDGCGQALASLLRTCPLLSTLRLQACGFGPSFFLSHQTALGSAFQGASGAHPARLTLPGN
TASRVQAAQCLVVPDLCLPGVGECKGGSNGQCTPLTPHRAEEGCALAHLTLSANHLGDKA
RDLCRCLSLCPSLISLDLSANPEISCVSLEELLSTLQKRPQGLSFLGLSGCAIQGPLGLG
LWDKIAAQLRELQLCSRRLCAEDRDAVRQLRPSRPCPGECTLDHGSKLFFRRL
Download sequence
Identical sequences ENSPANP00000011118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]