SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011126 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011126
Domain Number 1 Region: 125-238
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.15e-36
Family PDI-like 0.001
Further Details:      
 
Domain Number 2 Region: 443-590
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.39e-35
Family PDI-like 0.00074
Further Details:      
 
Domain Number 3 Region: 12-120
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.86e-35
Family PDI-like 0.003
Further Details:      
 
Domain Number 4 Region: 240-348
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.83e-21
Family Calsequestrin 0.037
Further Details:      
 
Domain Number 5 Region: 346-477
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000625
Family PDI-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011126   Gene: ENSPANG00000017763   Transcript: ENSPANT00000021667
Sequence length 598
Comment pep:known_by_projection chromosome:PapAnu2.0:3:170643499:170664571:-1 gene:ENSPANG00000017763 transcript:ENSPANT00000021667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSSNRENDLEVKEENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANI
LKDNDPPIPVAKIDATSASMLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREV
SQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELNKRS
PPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPFDYNGPREKYGIVDYMIEQSGPPS
KEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHAFSTEIAKF
LKVSQGQLVVMQPEKFQSKYEPRSHVMDVQGSTQDSAIKDFVLKYALPLVGHRKASNEAK
RYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGL
SESGEDVNAAILDESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPV
KVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYSSLAKKYKGQKGLVIAKMDATA
NDIPSDRYKVEGFPTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
Download sequence
Identical sequences ENSPANP00000011126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]