SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011137 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011137
Domain Number 1 Region: 781-1034
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.93e-89
Family Eukaryotic proteases 0.00000004
Further Details:      
 
Domain Number 2 Region: 359-516
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-36
Family MAM domain 0.0092
Further Details:      
 
Domain Number 3 Region: 537-649
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-24
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 4 Region: 246-350
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.41e-18
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 5 Region: 54-163
Classification Level Classification E-value
Superfamily SEA domain 3.01e-16
Family SEA domain 0.0052
Further Details:      
 
Domain Number 6 Region: 656-693
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 697-790
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000876
Family Scavenger receptor cysteine-rich (SRCR) domain 0.014
Further Details:      
 
Domain Number 8 Region: 196-236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011137   Gene: ENSPANG00000017001   Transcript: ENSPANT00000020390
Sequence length 1035
Comment pep:known_by_projection chromosome:PapAnu2.0:3:28336716:28468875:1 gene:ENSPANG00000017001 transcript:ENSPANT00000020390 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKRSVSSRHHSLSSYEIMFATLFAILVVLCAGLIAVSWLTIKESQRGAALGQSHEVRG
TFKITSGVTYNPNLQDKLSVDFKVLAFDLQQMIDEIFLSSTLKNEYKNSRVLQFENGSII
VTFELFFAQWVSDENVKEELIQGVEANKSSQLVTFHIDLNSVDILASLENFSTVSPATTS
GKLTTTSHLATPGNVSVECPPGSSPCADALTCIKADLFCDGEVNCPDGSDEDNKMCATVC
DGRFLLTGSSGSFQATHYPKPSESSVVCQWIIRVNQGLSIKLSFDHFNIYYTDILNIYEG
VGSSKILRASIWETNPGTIRIFSNQVTATFLIESDESDYVGFNVTYTAFNSSELNNYEKI
NCNFEDGFCFWVQDLNDDNEWERIQGSTFLPFTGPNFDHTFGNASGFYISTPTGPGGREH
VGLLSLPLDPTLEPACLSFWYHMYGENVHKLSINISNDQNTEKTVFQKEGNYGENWNYGQ
VTLNETVKFKVGFHAFKNKILSNIALDDISLTHGICNGSLYPEPTLVPTPPPELPTDCGG
PFELWEPNTTFSSMNFPNSYPNLAFCVWILNAQKGKNIQLHFQEFDLENINDVVEIRDGG
EADSLFLRTAVYTGPGPVKDVFSTTNRMTVLLITNDALARGGFKANFTTGYHLGIPEPCK
EDNFQCKNGECVPLANLCDGHLHCEDGSDEADCGRKGNGTTNNNGLVQFRIQSLWHTACA
ENWTTHISNDVCQLLGLGSGNSSMPIFSTNGGPFVKLNTAPDGSLILTPSQQCLQDSLIR
LRCNHKSCGKKLVAQDITPKIVGGSNAEEGAWPWVVGLYYGGRLLCGASLVSSDWLVSAA
HCVYGRNLEPSKWTAVLGLHMTSNLNSPQTVSLLIDQIVINPHYNRRRKDNDIAMMHLEF
KVNYTDYIQPICLPEENQVFPAGRNCSIAGWGRVVYQGSTANILQEADVPLLSNEKCQQQ
MPEYNITENMICAGYEEGGIDSCQGDSGGPLMCQENNRWFLAGVTSFGYKCALPNRPGVY
ARVPRFTEWIQSFLH
Download sequence
Identical sequences ENSPANP00000011137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]