SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011142 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011142
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily EF-hand 1.45e-50
Family p25-alpha 0.000000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011142   Gene: ENSPANG00000018345   Transcript: ENSPANT00000019517
Sequence length 176
Comment pep:known_by_projection chromosome:PapAnu2.0:20:49591904:49593368:-1 gene:ENSPANG00000018345 transcript:ENSPANT00000019517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASTDIAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKAVTGTDVDIVFS
KVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGG
AVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDTKVKK
Download sequence
Identical sequences A0A0D9QV65 A0A2K5CVA0 A0A2K5IUJ0 A0A2K5KZB5 A0A2K5QLF4 A0A2K5USV3 A0A2K5XGF5 A0A2K6BGG2 A0A2K6LUE8 A0A2K6Q7B6 A0A2K6TQB0 F6WYP5 U3CG63
NP_001181772.1.72884 XP_003936346.1.74449 XP_005592315.1.63531 XP_005592316.1.63531 XP_007992161.1.81039 XP_007992162.1.81039 XP_010345081.1.74449 XP_010353413.1.97406 XP_011756130.1.29376 XP_011756133.1.29376 XP_011787448.1.43180 XP_011787450.1.43180 XP_011852080.1.47321 XP_011918090.1.92194 XP_011918166.1.92194 XP_012323642.1.9421 XP_012323643.1.9421 XP_014981805.1.72884 XP_017394799.1.71028 XP_017707830.1.44346 XP_017707831.1.44346 ENSMMUP00000012860 ENSMMUP00000012861 ENSPANP00000011142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]