SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011148 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011148
Domain Number 1 Region: 122-442
Classification Level Classification E-value
Superfamily PAZ domain 4.4e-76
Family PAZ domain 0.0038
Further Details:      
 
Domain Number 2 Region: 420-757
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.01e-69
Family PIWI domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011148   Gene: ENSPANG00000022557   Transcript: ENSPANT00000026613
Sequence length 758
Comment pep:known_by_projection chromosome:PapAnu2.0:10:65921365:65957762:1 gene:ENSPANG00000022557 transcript:ENSPANT00000026613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRARTRARGRARRRESYQQEAPGGPGAPGSATIQEPTQLQRTPRPLREEVPVVRPLQP
RGAGGAAQSQGVKEPGPEAGSHTAPLQERRIGGVFQDLVVNTRRYMMHVKDSKTGSEGTV
VQLLANHFRVISRPQWVAYKYNVDYRPDIEDGNLRTILLDQHRRKFGECHIFDGNSLLLS
RPLKERRVEWLSMTKDKKFVKITVEFSKEIRPTSPDCLRYYNILFRRTFKLLDFEQVGRN
YYTKKKAIQLYRHGTSLEIWLGYVTSILQYENGITLCADVSHKLLRIETAYDFIKRTSAE
AQTGSIREEVTNKLIGSIVLTKYNNKTYRVDDIDWKQNPEDTFNRSDGSKITYIDYYRQQ
HKEIVTVKKQPLLVSQGRWKKGLTGTQREPILLIPQLCSMTGLTDEIRKDYSTMKELAKH
TRLSPRRRHHTLKEFINTIQDNKKVRDLLQLWDLKFDTNFLSVSGRVLKNANIVQGRRMV
KANSQGDWSREIRELPLLNAMPLHSWLILHSRSSHREAMSLKSHLQSVTAPMGITMKPAE
MIEVDGDANSYIDTLRKYTRPTLQMGMSCWLVFKVICILPNDDKHRYDSIKRYLCTKCPI
PSQCVVKKTLEKVQARTIVTKIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQK
SIAGFVASTNAELTKWYSQCVIQKTGEELVKELQTCLKAALDVWCKNESSMPHSIIVYRD
GVGDGQLQALLDHEAKKMSTYLKTLSPNNFTLAFIVVK
Download sequence
Identical sequences ENSPANP00000011148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]