SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011170 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011170
Domain Number 1 Region: 155-261
Classification Level Classification E-value
Superfamily ERP29 C domain-like 1.7e-29
Family ERP29 C domain-like 0.00000353
Further Details:      
 
Domain Number 2 Region: 36-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.85e-24
Family ERP29 N domain-like 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011170   Gene: ENSPANG00000003387   Transcript: ENSPANT00000014905
Sequence length 261
Comment pep:known_by_projection chromosome:PapAnu2.0:11:111189720:111199994:1 gene:ENSPANG00000003387 transcript:ENSPANT00000014905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVSRSASLSQLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVITKSKFVLVKF
DTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYL
FRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEGRQAL
LKRGQDNLSSVKETEKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEE
LQKSLNILTAFQKKGAEKEEL
Download sequence
Identical sequences A0A096NE61
ENSPANP00000011170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]