SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011174 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011174
Domain Number 1 Region: 412-802
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.35e-128
Family Oxysterol-binding protein 0.0000346
Further Details:      
 
Domain Number 2 Region: 40-127,158-278
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-24
Family Pleckstrin-homology domain (PH domain) 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011174   Gene: ENSPANG00000009379   Transcript: ENSPANT00000026823
Sequence length 902
Comment pep:known_by_projection chromosome:PapAnu2.0:11:71743799:71887929:-1 gene:ENSPANG00000009379 transcript:ENSPANT00000026823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGGLADGEPDRTSILPYSEVAEVQETLLGDSKDVLGPSTVVANSDESQLLTPGKMSQRQ
GKEAYPTPTKDLYQPSLSPASPHSQGFERGKEDISQNKDESSLSMSKSKSESKLYNGSEK
DSSTSSKLTKKESLKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKL
WCVLKPGVLLIYKTQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPK
GEAVGSITQPLPSSYLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSS
DSTHVTFYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEVM
GKSEESDTDTSERQDDSYIEPEPVEPLKETTYTEQSHEELGEAGEASQTETVSEENKSLI
WTLLKQVRPGMDLSKVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRLKKVVK
WYLSGFYKKPKGLKKPYNPILGETFRCLWIHPRTNSKTFYIAEQVSHHPPISAFYVSNRK
DGFCLSGSILAKSKFYGNSLSAILEGEARLTFLNRGEDYVMTMPYAHCKGILYGTMTLEL
GGTVNITCQKTGYSAILEFKLKPFLGSSDCVNQISGKLKLGKEVLATLEGHWDSEVFITD
KKTDNSEVFWNPTPDIKQWRLIRHTVKFEEQGDFESEKLWQRVTRAINAKDQTEATQEKY
VLEEAQRQAARDRKTKNEEWSCKLFELDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQ
TKVKHRTPMVNVPKMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPSTRRKKGIEL
GDIQSSIESIKQTQEEIKRNIMALRNHLVSSTPATDYFLQQKDYFIIFLLILLQVIINFM
FK
Download sequence
Identical sequences A0A096NE65 A0A1D5R0T7 A0A2K5TKF4
ENSPANP00000011174 XP_005571650.1.63531 XP_015007764.1.72884 XP_015007765.1.72884 XP_015286718.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]