SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011180 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011180
Domain Number 1 Region: 24-185,223-348
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.75e-62
Family FCH domain 0.0022
Further Details:      
 
Domain Number 2 Region: 494-679
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.35e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000964
Further Details:      
 
Domain Number 3 Region: 731-786
Classification Level Classification E-value
Superfamily SH3-domain 4.33e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011180   Gene: ENSPANG00000018738   Transcript: ENSPANT00000026044
Sequence length 1071
Comment pep:known_by_projection chromosome:PapAnu2.0:1:157467474:157710967:-1 gene:ENSPANG00000018738 transcript:ENSPANT00000026044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPAKFKKDKEIIAEYDTQVKEIRAQLTEQMKCLDQQCELRVQLLQDLQDFFRKKAEIE
MDYSRNLEKLAERFLAKTRSTKDQQFKKDQNVLSPVNCWNLLLNQVKRESRDHTTLSDIY
LNNIIPRFVQVSEDSGRLFKKSKEVGQQLQDDLMKVLNELYSVMKTYHMYNADSISAQSK
LKEAEKQEEKQIGKSVKQEDRQTPRSPDSTANVRIEEKHVRRSSVKKIEKMKEKRQAKYT
ENKLKAIKARNEYLLALEATNASVFKYYIHDLSDLIDQCCDLGYHASLNRALRTFLSAEL
NLEQSKHEGLDAIENAVENLDATSDKQRLMEMYNNVFCPPMKFEFQPHMGDMASQLCAQQ
PVQSELVQRCQQLQSRLSTLKIENEEVKKTMEATLQTIQDIVTVEDFDVSDCFQYSNSME
SVKSTVSETFMSKPSIAKRRANQQETEQFYFTKMKEYLEGRNLITKLQAKHDLLQKTLGE
SQRTDCSLARRSSTVRKQDSSQAIPLVVESCIRFISRHGLQHEGIFRVSGSQVEVNDIKN
AFERGEDPLAGDQNDHDMDSIAGVLKLYFRGLEHPLFPKDIFHDLMACVTMDNLQERALH
IRKVLLVLPKTTLIIMRYLFAFLNHLSQFSEENMMDPYNLAICFGPSLMSVPEGHDQVSC
QAHVNELIKTIIIQHENIFPSPRELEGPVYSRGGSMEDYCDSPHGETTSVEDSTQDVTAE
HHTSDDECEPIEAIAKFDYVGRTARELSFKKGASLLLYQRASDDWWEGRHNGIDGLIPHQ
YIVVQDTEDGVVERSSPKSEIEVISEPPEEKVTARAGASCPSGGHVADIYLANINKQRKR
PESGSIRKTFRSDSHGLSSSLTDSSSPGVGASCRPSSQPIMSQSLPKEGPDKCSISGHGS
LNSISRHSSLKNRLDSPQIRKTATAGRSKSFNNHRPMDPEVIAQDIEATMNSALNELREL
ERQSSVKHTPDVVLDTLEPLKTSPVVAPTSEPSSPMHTQLLKDPEPAFQRSASTAGDIAC
AFRPVKSVKMAAPVKPPATRPKPTVFPKTNATSPGVNSSTSPQSTDKSCTV
Download sequence
Identical sequences A0A096NE71 A0A0D9RQX3 A0A2K6A7C7 A0A2K6C966 A0A2K6KN95 G7MER6 G7NVB6
XP_005540687.1.63531 XP_007986878.1.81039 XP_007986879.1.81039 XP_011745182.1.29376 XP_011856412.1.47321 XP_014973535.1.72884 XP_017736403.1.44346 ENSPANP00000011180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]