SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011215 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011215
Domain Number 1 Region: 106-211
Classification Level Classification E-value
Superfamily TPR-like 0.00000000886
Family Tetratricopeptide repeat (TPR) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011215   Gene: ENSPANG00000018903   Transcript: ENSPANT00000011434
Sequence length 357
Comment pep:novel chromosome:PapAnu2.0:19:19207914:19209011:-1 gene:ENSPANG00000018903 transcript:ENSPANT00000011434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPHKANKLQAFVKTCKQDPSVLHPEEMHFLKEWIESMGGKVPPATQKAKSEENTKEEES
DSKKVEEDLKADKPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEMMDQANDKKVA
AIEALNDGELQKAIDLFIGAIKLPRLAILHAKRASVFIKLQKPNAVIRNDRAIEINPDST
QPYKWRGKAHLLGHWEETARDLALACELNYDEDASAMLKEVQPRAQKIAEHQRKYEQKRE
EREIKERIEQVKKAREEHERSQREEESRAQYGSFPGGFPRGMPGSFPGGMPGMGGGMPGM
AGMILSDPEVLAAMQDPEVMVAFQDVAQNPANMSKHQSNTKVMNLISKLSAIFGGQA
Download sequence
Identical sequences ENSPANP00000011215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]