SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011217 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011217
Domain Number 1 Region: 56-95,154-358,385-502
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.31e-112
Family TRM1-like 0.0000713
Further Details:      
 
Domain Number 2 Region: 600-628
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000196
Family CCCH zinc finger 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011217   Gene: ENSPANG00000009247   Transcript: ENSPANT00000003709
Sequence length 660
Comment pep:known_by_projection chromosome:PapAnu2.0:19:11884291:11896860:-1 gene:ENSPANG00000009247 transcript:ENSPANT00000003709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRSIVLWLSLTLRPTRVLCTARFFEGQSPGLPNPAAMENGTGPCGEECPREVQETTITE
GAAKIAFPSANEVFYNPVQEFNRDLTCAVITEFARIQLGAKGIQIKVPGEKDTQKVVVDL
SEQEEEKVELKENENLASGDQPRTAAVGEICEEGLHVLEGLAASGLRSIRFALEVPGLRS
VVANDTSARAVDLIRRNVQLNDVAHLVQPSQADARMLMYQHQRVSERFDVIDLDPYGSPA
PFLDAAVQAVSEGGLLCVTCTDMAVLAGNSGETCYSKYGAMALKSRACHEMALRIVLHSL
DLRANCYQRFVVPLLSISADFYVRVFVRVFTGQAKVKASASKQALVFQCVGCGAYHLQRL
GKASGVPGSRVKFSAACGPPVTPECEHCGQRHQLGGPVWAEPIHDLDFVGRVLEAVSANP
GRFHTSERIRGVLSVITEELPDVPLYYTLDQLSSTIHCNTPSLLQLRSALLHADFRVSLS
HACKNAVKTDAPASALWDIMRCWEKECPVKRERLSETSPAFRILSVEPRLQANFTIREDA
NPSSRQRGLKRFQANPEANWGPRPRARPGGKAADEAMEERRRLLQNKRKEPPEDAAQRAA
RLKTFPCKRFKEGTCQRGDQCCYSHSPPTPRVSADAVPDCPETSNQSPRGPGDAARPGID
Download sequence
Identical sequences A0A0A0MX33
ENSPANP00000011217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]