SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011232 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011232
Domain Number 1 Region: 3025-3283
Classification Level Classification E-value
Superfamily YWTD domain 7.46e-57
Family YWTD domain 0.0000016
Further Details:      
 
Domain Number 2 Region: 1269-1534
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-52
Family YWTD domain 0.00000195
Further Details:      
 
Domain Number 3 Region: 1892-2152
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-45
Family YWTD domain 0.0000114
Further Details:      
 
Domain Number 4 Region: 3870-4141
Classification Level Classification E-value
Superfamily YWTD domain 9.02e-44
Family YWTD domain 0.00000555
Further Details:      
 
Domain Number 5 Region: 1584-1841
Classification Level Classification E-value
Superfamily YWTD domain 2.75e-43
Family YWTD domain 0.0000238
Further Details:      
 
Domain Number 6 Region: 536-769
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-40
Family YWTD domain 0.0000105
Further Details:      
 
Domain Number 7 Region: 200-469
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-39
Family YWTD domain 0.0000794
Further Details:      
 
Domain Number 8 Region: 2201-2439
Classification Level Classification E-value
Superfamily YWTD domain 1.23e-27
Family YWTD domain 0.00019
Further Details:      
 
Domain Number 9 Region: 2913-3017,3276-3337
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.16e-21
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 85-188,473-521
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000612
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 11 Region: 1185-1263,1534-1578
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 12 Region: 848-888
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000654
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 13 Region: 3565-3605
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000124
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 14 Region: 3607-3643
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 15 Region: 24-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 16 Region: 3649-3694
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 17 Region: 3483-3523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 18 Region: 889-931
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 19 Region: 1014-1052
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.000088
Further Details:      
 
Domain Number 20 Region: 3365-3405
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 2689-2726
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000393
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 22 Region: 974-1011
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000471
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 23 Region: 3527-3566
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 24 Region: 1057-1097
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 25 Region: 2562-2602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 26 Region: 3444-3481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 27 Region: 2729-2763
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 28 Region: 2811-2847
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 29 Region: 930-968
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.00095
Further Details:      
 
Domain Number 30 Region: 3407-3445
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000109
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 31 Region: 2849-2888
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00055
Further Details:      
 
Domain Number 32 Region: 2769-2803
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 33 Region: 3328-3363
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 34 Region: 3736-3772
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 35 Region: 2526-2563
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 36 Region: 1846-1896
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000199
Family EGF-type module 0.012
Further Details:      
 
Domain Number 37 Region: 1105-1140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000301
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 38 Region: 1143-1178
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000393
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 39 Region: 802-847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000051
Family EGF-type module 0.041
Further Details:      
 
Domain Number 40 Region: 2655-2685
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000126
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 41 Region: 3781-3827
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000104
Family EGF-type module 0.052
Further Details:      
 
Domain Number 42 Region: 2155-2202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.012
Further Details:      
 
Domain Number 43 Region: 3691-3727
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 44 Region: 4193-4228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000081
Family EGF-type module 0.042
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011232
Domain Number - Region: 3820-3856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000168
Family EGF-type module 0.0091
Further Details:      
 
Domain Number - Region: 2478-2541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000358
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4230-4268
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000389
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 4265-4301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.041
Further Details:      
 
Domain Number - Region: 4372-4410
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.045
Further Details:      
 
Domain Number - Region: 4149-4182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0479
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4304-4337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.1
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011232   Gene: ENSPANG00000013191   Transcript: ENSPANT00000009526
Sequence length 4540
Comment pep:known_by_projection chromosome:PapAnu2.0:11:52696762:52779842:1 gene:ENSPANG00000013191 transcript:ENSPANT00000009526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELRGNCSRLGC
QHHCVPTLDGPTCYCNSSFQLQADSKTCKDFSVLSVYGTCSQLCTNTDGSFVCGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDNAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTK
LVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE
NYLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACEN
DQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRG
MDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDG
IHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNG
WMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFY
DRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGVGGAPPTVT
LLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGV
TCLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRF
KCENNRCIPNRWLCDGDNDCGNSEDESNATCSGRVKHPNQFSCASGRCIPISWTCDLDDD
CGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQF
KCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRW
RCDGDTDCMDSSDEKSCEGVTHVCDPSVKFGCKDSARCISKAWVCDGDNDCEDNSDEENC
ESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAP
GEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES
CRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDK
IYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTT
LLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLT
VDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNT
LAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGRGPCSHLCLINYNRT
VSCACPHLMKLHKDKTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVL
DYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTN
KKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSG
QKGPVGLAIDFPESKLYWISSGNHTINRCNLDGSGLEVIEAMRSQLGKATALAIMGDKLW
WADQVSEKMGTCSKADGSGSVVLRNSTTLVMHMKVYDESIQLDHKGTNPCSVNNGDCSQL
CLPTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSG
TSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIY
WTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDG
TERVVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFS
VSVFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCA
VANGGCQQLCLYRGRGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNL
NAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSRRITIVE
NVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLD
ECQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDK
IERCEYDGSHRYVSLRGGSVGPHSVAVRGQARLWWPSDWNLPETLKAHRALPKSTHILNS
TAAKNPMHLALPQQPSPCRELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQDDLTCR
AVNSSCRAQDEFECANGECINFSLTCDGVPHCKDKSDEKPSYCNSRRCKKTFRQCSNGRC
VSNMLWCNGADDCGDGSDEIPCNTRSCSWAPMGFREGTVSGWCRQCPTGRALFNFCATDC
SSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNYFACP
SGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCGDGSD
EAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTCDDREFM
CQNRQCIPKHFVCDHDRDCADGSDESPECEYPTCGPSEFRCANGRCLSSRQWECDGENDC
HDQSDEAPKNPHCTSPEHKCNASSQFLCSSGRCVAEVLLCNGQDDCGDGSDERGCHINEC
LSHKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPCSQRCINTHGSYK
CLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAVALDF
DYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCDKGRD
TIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSSRSVIV
DTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLFEDYV
YWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNGGCSNL
CLLSPGGGHKCACPTNFYLGSDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCGDHSD
EPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKCTNTN
RCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCVDGSD
EPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQFRCK
NNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDCADGS
DEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACSTGVRTCPLDEFQCNNT
LCKPLAWKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGMDNCGD
GTDEEDCEPPTAQTTHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSIDPKLTS
CATNASICGDEARCVRTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNNTKGG
HLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESVRIDA
MDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMPRGIA
IDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDWGNHP
KIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPIVAAD
SKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVNLTGGLSHASDVVLYHQHKQ
PEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTALPAAPRPGTCNLQC
FNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPTGFTG
PKCTQQVCAGYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQMAADG
SRQCRCTAYFEGLRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCIGHCSNG
GSCTMNSKMMPECQCPPHMTGPRCEEHVFSQQQPGHIASILIPLLLLLLVLLVAGVVFWY
KRRVQGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPTNFTN
PVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
Download sequence
Identical sequences ENSPANP00000011232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]