SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011268 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011268
Domain Number 1 Region: 212-402
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.14e-59
Family Eukaryotic proteases 0.0000000805
Further Details:      
 
Domain Number 2 Region: 48-110
Classification Level Classification E-value
Superfamily GLA-domain 2.35e-25
Family GLA-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 134-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000227
Family EGF-type module 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011268   Gene: ENSPANG00000002645   Transcript: ENSPANT00000014496
Sequence length 473
Comment pep:known_by_projection chromosome:PapAnu2.0:X:127764738:127797974:1 gene:ENSPANG00000002645 transcript:ENSPANT00000014496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRVNVIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNL
ERECMEEKCNFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCP
FGFEGKNCELDVTCNIKNGRCKQFCKNTADNKVVCSCTEGYRLAENQKSCEPAVPFPCGR
VSVSQTSTLTRAETVFSDVEYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPW
QVVLNGKVDAFCGGSIVNEKWVVTAAHCVETDAKITVVAGEHNIEETEHTEQKRNVIRII
PHHNYNATINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVF
NKGRSASVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGERREQLICSLQLVETLRK
NPTACLQQCSESRKKLKLPRPEDISNMSPLTGMPLKWRRVQQAQRHKSFQSAN
Download sequence
Identical sequences A0A096NEF0
ENSPANP00000011268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]