SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011271 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011271
Domain Number 1 Region: 9-293
Classification Level Classification E-value
Superfamily TPR-like 7.33e-78
Family Tetratricopeptide repeat (TPR) 0.00000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011271   Gene: ENSPANG00000023325   Transcript: ENSPANT00000015444
Sequence length 295
Comment pep:known_by_projection chromosome:PapAnu2.0:19:40790026:40818968:-1 gene:ENSPANG00000023325 transcript:ENSPANT00000015444 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNSGKEAEAMALLAEAERKVKNSQSFFSGLFGGSSKIEEACEIYARAANMFKMAKNWSA
AGNAFCQAAQLHLQLQSKHDAATCFVDAGNAFKKADPQEAINCLMRAIEIYTDMGRFTIA
AKHHISIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAGYAALLEQYQK
AIDIYEQVGTNAMDSPLLKYSAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDSRE
CKLMKKLLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKTIQGDEEDLR
Download sequence
Identical sequences A0A024R0R9 A0A0D9S2L0 A0A2J8U775 A0A2K5JZP9 A0A2K5N581 A0A2K6AJ16 A0A2K6C5H6 A0A2K6KA68 A0A2K6QEL6 F6Z997 G2HHR6 G3RUI1 I7GH32 P54920
ENSP00000263354 ENSPANP00000011271 ENSMMUP00000019320 ENSP00000263354 9544.ENSMMUP00000019320 9598.ENSPTRP00000043338 9606.ENSP00000263354 gi|47933379|ref|NP_003818.2| NP_001181517.1.72884 NP_001233558.1.37143 NP_001274579.1.63531 NP_003818.2.87134 NP_003818.2.92137 XP_003814157.1.60992 XP_007995554.1.81039 XP_010375699.1.97406 XP_011734404.1.29376 XP_011781813.1.43180 XP_011825239.1.47321 XP_011936074.1.92194 XP_017744748.1.44346 XP_018871151.1.27298 ENSPTRP00000043338 ENSPTRP00000043338 ENSMMUP00000019320 ENSMMUP00000031552 ENSP00000263354 GO.39440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]