SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011325 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011325
Domain Number 1 Region: 131-193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.57e-16
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 80-142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000114
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 3 Region: 22-87
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000983
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011325   Gene: ENSPANG00000018149   Transcript: ENSPANT00000016252
Sequence length 252
Comment pep:known_by_projection chromosome:PapAnu2.0:1:156822504:156835079:-1 gene:ENSPANG00000018149 transcript:ENSPANT00000016252 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFWCACCLMVARWVSASDAEHCPELPPVNNSIFIAKEVEGQILGTYVCIKGYHLVGKKT
VFCNASKEWDNTTTECRLGHCPDPVLVNGEFSTSGPVNVSDKITFKCNDHYILKGSNWSQ
CLEDHTWAPPFPICKSRDCDPPGNPAHGYFKGDNFTLGSTISYYCKDRYYLVGMQEQQCI
DGEWSSALPVCKLIQEAPKPECEKALLAFQERKDLCEAIENFMQQLKESGMTMEELKYSL
ELKKAELKAKLL
Download sequence
Identical sequences A0A2I3MB60
ENSPANP00000011325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]