SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011367 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011367
Domain Number 1 Region: 364-499
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.41e-40
Family Synaptotagmin-like (S variant) 0.00000698
Further Details:      
 
Domain Number 2 Region: 225-337
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.28e-39
Family Synaptotagmin-like (S variant) 0.0000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011367   Gene: ENSPANG00000018998   Transcript: ENSPANT00000012259
Sequence length 523
Comment pep:known_by_projection chromosome:PapAnu2.0:11:32705215:32767410:-1 gene:ENSPANG00000018998 transcript:ENSPANT00000012259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFHKEDGVNGLCQKALHIVTELCFAGQVEWEKCLGIFPRDRGSQGGGSTDISVSLLAVV
VSFCGLALLVVSLFVFWKLCWPCWKSKPVTSNVTTLPQSISSAPTEVFETEEKKEIKENE
KPAVRAIEPAIKISHTSPDIPAEVQTALKEHLIKHARVQRQITEPTSSSRHNSFRRHLPR
QMQVSSVDFSMGTEPVLQRGETTTSIGRIKPELYKQRSVDSEGNQKEDVKTCGKLNFTLQ
YDYENELLVVKIIKALDLPAKDFTGTSDPYVKMYLLPDRKKKFQTRVHRKTLNPLFDETF
QFPVAYDQLSNRKLHFSVYDFDRFSRHDMIGEVILDNLFEVSDLSREATVWKDIHCATTE
SVDLGEIMFSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTT
TKKNTLNPVYNEAIIFDIPPENVDQVSLSIAVMDYDRVGHNEVIGVCRTGLDAEGLGRDH
WNEMLAYHRKPITHWHPLLELPGRATSFDSQGSCPSPKPPSTP
Download sequence
Identical sequences A0A096NEP0 A0A2K5M2K2 A0A2K5XB34
XP_011833159.1.47321 XP_011927352.1.92194 ENSPANP00000011367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]