SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011437 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011437
Domain Number 1 Region: 28-84,205-343,392-438
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.13e-75
Family Inositol polyphosphate kinase (IPK) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011437   Gene: ENSPANG00000009897   Transcript: ENSPANT00000016143
Sequence length 441
Comment pep:known_by_projection chromosome:PapAnu2.0:2:85552843:85580915:1 gene:ENSPANG00000009897 transcript:ENSPANT00000016143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCVCQTMEVGQYGKNASRAGDRGVLLEPFIHQVGGHSSMMRYDDHTVCKPLISREQRFYE
SLPPEMKEFTPEYKGVVSVCFEGDSDGYINLVAYPYVESETVEQDDTPEREQPRRKHSRR
SLHRSGSGSDHKEEKASLSLETSESSQDAKSPKVELHSHSEVPFQMLDGNSGLSSEKISH
NPWSLRCHKQQLSRMRSESKDRKLYKFLLLENVVHHFKYPCVLDLKMGTRQHGDDASAEK
AARQMRKCEQSTSATLGVRVCGMQVYQLDTGHYLCRNKYYGRGLSIEGFRNALYQYLHNG
LDLRRDLFEPILSKLRGLKAVLERQASYRFYSSSLLVIYDGKECRAESCLDRRSEMRLKH
LDMVLPEVASSCGPSTSPSNTSPEAGPSSQPKVDVRMIDFAHSTFKGFRDDPTVHDGPDR
GYVFGLENLISIMEQMRDENQ
Download sequence
Identical sequences A0A2I3LJC3
ENSPANP00000011437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]