SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011462 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011462
Domain Number 1 Region: 86-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.77e-43
Family Glutathione S-transferase (GST), C-terminal domain 0.00000147
Further Details:      
 
Domain Number 2 Region: 3-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.39e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.0000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011462   Gene: ENSPANG00000015725   Transcript: ENSPANT00000028175
Sequence length 218
Comment pep:novel chromosome:PapAnu2.0:1:110580296:110586636:1 gene:ENSPANG00000015725 transcript:ENSPANT00000028175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMILGYWDIRGLAHAIRLLLEYTDSNYEEKKYRMGHAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGTHKITQSNAILRYIARKHNLCGETEEEKILVDILENQLMDSRMEMVRLCFDPNF
EKLKPKYLEELPEKLKLYSQFLGKRSWFTGDKITFVDFLAYDVLDMRRIVEPGCLDAFPN
LKDFISRFEGLKKISAYMKSSRFHRGLLFGTTATWNST
Download sequence
Identical sequences A0A096NEX4
ENSPANP00000011462 ENSPANP00000014233 ENSPANP00000019116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]