SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011463 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011463
Domain Number 1 Region: 298-525
Classification Level Classification E-value
Superfamily HCP-like 2.88e-26
Family HCP-like 0.016
Further Details:      
 
Domain Number 2 Region: 4-103,130-166,280-310
Classification Level Classification E-value
Superfamily TPR-like 0.00000000455
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011463   Gene: ENSPANG00000008850   Transcript: ENSPANT00000018610
Sequence length 618
Comment pep:known_by_projection chromosome:PapAnu2.0:17:90767879:90807248:1 gene:ENSPANG00000008850 transcript:ENSPANT00000018610 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSHEEPQDIYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYEACRYLAARCHYAAKEHQQALDILDMEEPINKRLFEKYLKDESGFKDPSSD
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLESLPLSKLGNEEQELLRFLFENKLKKYNKPSETVIPESVNGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVNMEFTPSYVLCLGMHLSLNFSKPNELFYLSHKLVDLYPSNPVSW
FAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQ
LMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAE
KWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTY
SAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKDKL
KCYDFDVHTMKTLKTIISPPWDFREFEVEKQTAEEAGPTPLEPSRKTPDSRPSLEETFEI
EMNESDMMLETSMSDHST
Download sequence
Identical sequences ENSPANP00000011463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]