SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011473 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011473
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000654
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.003
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011473
Domain Number - Region: 9-184
Classification Level Classification E-value
Superfamily ARM repeat 0.0863
Family Mo25 protein 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011473   Gene: ENSPANG00000017816   Transcript: ENSPANT00000003304
Sequence length 212
Comment pep:known_by_projection chromosome:PapAnu2.0:2:43473047:43486970:-1 gene:ENSPANG00000017816 transcript:ENSPANT00000003304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTDKPTCIPPELPKMLKEFAKAAIRSQPQDLIQWAADYFEALSRGETPPVRERSEQAA
LCNWTELTPELLKVLHSQVAGRLIVHAEELAQMWKVVNLPADLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAEVDGEISASHV
SRMLNYIEQEVIGPDGIITVNDFTQNPRVRLE
Download sequence
Identical sequences ENSPANP00000011473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]