SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011474 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011474
Domain Number 1 Region: 395-499
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.34e-30
Family PDI-like 0.0041
Further Details:      
 
Domain Number 2 Region: 264-379
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.35e-27
Family PDI-like 0.0076
Further Details:      
 
Domain Number 3 Region: 110-254
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.33e-26
Family PDI-like 0.0096
Further Details:      
 
Domain Number 4 Region: 31-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000202
Family ERP29 N domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011474   Gene: ENSPANG00000019864   Transcript: ENSPANT00000019073
Sequence length 516
Comment pep:known_by_projection chromosome:PapAnu2.0:2:42536326:42606843:1 gene:ENSPANG00000019864 transcript:ENSPANT00000019073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCWFALILWKVVLPLWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEAAAENHL
RLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNR
AVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAPWCSM
CKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLFQYDN
YGSTAEDILEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMFHAPW
CGHCKKLLCSTSTASEAVMHGWPQSSGVLAAVDATVNKALAERFHISEFPTLKYFKNGEK
YAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVMFYA
PWCPHCKKVIPHFTAAADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYHYGK
FTEKYDSDRTELGFTNYIRALREGDHERLGKKKEEL
Download sequence
Identical sequences ENSPANP00000011474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]