SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011493 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011493
Domain Number 1 Region: 209-235,270-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.11e-38
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 454-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.89e-31
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 3 Region: 65-122
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000344
Family Fibrinogen C-terminal domain-like 0.0037
Further Details:      
 
Domain Number 4 Region: 36-72
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000014
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011493   Gene: ENSPANG00000006309   Transcript: ENSPANT00000026208
Sequence length 793
Comment pep:known_by_projection chromosome:PapAnu2.0:20:58151515:58244352:1 gene:ENSPANG00000006309 transcript:ENSPANT00000026208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLISIGGRVVDLISVQQGSLGNFSDLQIDSCGISDRCSPNYCEHGGECSQSWSAFHCNC
TNTGYRGATCHNSIYEQSCEAYKHRGNTSGFYYIDSDGSGPLEPFLLYCNMTETTWTIIQ
HNGSDLTRVRNTNPENPYAGFFEYVASMEQLQATIDRAEHCEQEFTYYCKKSRLVNKQDG
TPLSWWVGRTNETQTYWGGSLPDLQKCTCGLEGNCIDSQYYCNCDADRNEWTNDTGLLSY
KEHLPVTKIVITDTGRLHSEAAYKLGPLLCRGDRSFWNSASFDTEASYLHFPTFHGELSA
DVSFFFKTTASSGVFLENLGITDFIRIELRSPTVVTFSFDVGNGPFEISVQSPTHFNDNQ
WHHVRIERNMKEASLQVDQLTRKTQPAPADGHVLLQLNSQLFVGGTATRQRGFLGCIRSL
QLNGMTLDLEERAQVTPEVQPGCRGHCSSYGKLCRNGGKCRERPIGFFCDCTFSAYTGPF
CSNEISAYFGSGSSVIYNFQENYLLSKNSSSHAASFHGDMKLSREMIKFSFRTTRTPSLL
LFVSSFYKEYLSVIIAKNGSLQIRYKLNRYQEPDVVNFDFKNMADGQLHHVVINREEGVV
FIEIDNNTRRQVHLSSGTEFSAVKSLVLGRILEHSDVDQETALAGAQGFTGCLSAVQLSH
VAPLKAALHPSHPDPVTVTGHVTESSCVAQPGTDATSRERTHLFADHSGTIDDKEPLANA
IKSDSAVIGGLIAVVIFILLCITAIAVRIYQQKRLYKRSEAKRSENVDSAEAVLKSELNI
QNAVSENQKEYFF
Download sequence
Identical sequences ENSPANP00000011493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]