SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011496 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011496
Domain Number 1 Region: 319-637
Classification Level Classification E-value
Superfamily TPR-like 4.17e-120
Family Tetratricopeptide repeat (TPR) 0.000000000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011496   Gene: ENSPANG00000014887   Transcript: ENSPANT00000023646
Sequence length 639
Comment pep:known_by_projection chromosome:PapAnu2.0:11:7353626:7370716:1 gene:ENSPANG00000014887 transcript:ENSPANT00000023646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMRELVEAECGGANPLMKLAGHFTQDKALRQEGLRPGPWPPGAPASEAASKPLGVASED
ELVAEFLQDQNAPLVSRAPQTFKMDDLLAEMQQIEQSNFRQAPQRAPGVADLALSENWAQ
EFLAAGDAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTA
TDRWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVSLESGAGSGRAQA
EQWAAEFIQQQGTSDAWVDQFTRPVNTSALDMEFERAKSAIESDVDFWDKLQAELEEMAK
RDAEAHPWLSDYDDLTSATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEA
AVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQR
QACETLRDWLRYTPAYAHLVTPAEEGAGGAGLGPSKRILGSLLSDSLFLEVKELFLAAVR
LDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEE
AVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGPRGEGGAMS
ENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Download sequence
Identical sequences A0A096NF08 A0A0D9RC06 A0A0S2Z4H1 A0A2J8TBS6 A0A2K5M4L7 A0A2K5ZX54 G3QL79 P50542
NP_001124497.1.87134 NP_001124497.1.92137 NP_001124498.1.87134 NP_001124498.1.92137 XP_003820299.1.60992 XP_007965647.1.81039 XP_007965648.1.81039 XP_007965649.1.81039 XP_007965651.1.81039 XP_007965652.1.81039 XP_007965653.1.81039 XP_007965654.1.81039 XP_008971893.1.60992 XP_008971894.1.60992 XP_011519099.1.92137 XP_011519100.1.92137 XP_011519101.1.92137 XP_011519102.1.92137 XP_011838453.1.47321 XP_011838454.1.47321 XP_011909808.1.92194 XP_011909809.1.92194 XP_011909810.1.92194 XP_016875238.1.92137 XP_018894762.1.27298 XP_018894763.1.27298 XP_018894764.1.27298 XP_018894765.1.27298 XP_018894767.1.27298 ENSP00000400647 ENSP00000410159 gi|196259774|ref|NP_001124497.1| gi|196259776|ref|NP_001124498.1| ENSPANP00000011496 ENSP00000400647 ENSP00000410159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]