SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011521 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011521
Domain Number 1 Region: 37-136
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000177
Family Thioltransferase 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011521   Gene: ENSPANG00000013000   Transcript: ENSPANT00000016358
Sequence length 165
Comment pep:known_by_projection chromosome:PapAnu2.0:3:93967582:93989380:1 gene:ENSPANG00000013000 transcript:ENSPANT00000016358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHSALALCLLLVAVSSNLAIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKP
LMVIHHLEDCQYSQALKQVFSQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMF
VDPSLTVRADIAGRYSNRLYTYEPQDLPLLIENMKKALRLIQSEL
Download sequence
Identical sequences A0A096NF33 A0A2K6BNR5 G7MLR3 G7P0T1
9544.ENSMMUP00000021064 XP_001104313.1.72884 XP_005550104.1.63531 XP_005550105.1.63531 XP_011729360.1.29376 XP_011729361.1.29376 XP_014989417.1.72884 XP_014989418.1.72884 ENSMMUP00000021064 ENSPANP00000011521 ENSMMUP00000021064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]