SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011541 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011541
Domain Number 1 Region: 192-263
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.99e-18
Family PHD domain 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011541
Domain Number - Region: 304-341
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0102
Family PHD domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011541   Gene: ENSPANG00000016120   Transcript: ENSPANT00000008191
Sequence length 823
Comment pep:known_by_projection chromosome:PapAnu2.0:X:43943913:44089002:1 gene:ENSPANG00000016120 transcript:ENSPANT00000008191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRHRPVSSSDSSDESPSTSFTSGSMYRIKSKIPNEHKKPAEVFRKDLISAMKLPDSHHI
NPDSYYLFADTWKEEWEKGVQVPASPDTVPQPSLRIIAEKVKDVLFIRPRKYIHCSSPDT
TEPGYINIMELAASVCRYDLDDMDIFWLQELNEDLAEMGCGPVDENLMEKTVEVLERHCH
ENMNHAIETEEGLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNVCVHQACYGILKVPEG
SWLCRSCVLGIYPQCVLCPKKGGAMKTTKTGTKWAHVSCALWIPEVSIACPERMEPITKI
SHIPPSRWALVCNLCKLKTGACIQCSIKSCITAFHVTCAFEHGLEMKTILDEGDEVKFKS
YCLKHSQNRQKLGEAEYPHHRAKEQSQAKSEKTSLRAQKLRELEEEFYSLVRVEDVAAEL
GMPTLAVDFIYNYWKLKRKSNFNKPLFPPKEDEENGLVQPKEESIHTRMRMFMHLRQDLE
RVRNLCYMISRREKLKLSHNKIQEQIFGLQVQLLNQEIDAGLPLTNALENSLFYPPPRIT
LKLKMPRSTPEDHRNSSTETDQQPHSPDSSSSVHSIRSMQVPQESLEMRTKSYPRYPLES
KNNRLLASLSHSRSEAKESSPAWRTPSSECYHGQSLGKPLVLQAALHGQSSIGNGKSQPN
SKFAKSNGLEGSWSGNVTQKDSSSEMFCDQEPVLSPHLVSQGSFRKSTVEHFSRSFKETT
NRWVRNAEDLQCYVKPTKNMSPKEQFWGRQLLRRSAGRAPYQENDGYCPDLELSDSEAES
DGNKEKVRVRKDSSDRENPPHDSRRDCHGKSKTHPLSHSSMQR
Download sequence
Identical sequences A0A096NF52 A0A2K5NG10 A0A2K5Y3M5
ENSPANP00000011541 XP_007989687.1.81039 XP_007989688.1.81039 XP_011838216.1.47321 XP_011925603.1.92194 XP_011925604.1.92194 XP_011925605.1.92194 XP_011925606.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]