SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011547 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011547
Domain Number 1 Region: 1779-1901
Classification Level Classification E-value
Superfamily Bromodomain 4.45e-36
Family Bromodomain 0.0002
Further Details:      
 
Domain Number 2 Region: 529-656
Classification Level Classification E-value
Superfamily DNA-binding domain 1.05e-24
Family Methyl-CpG-binding domain, MBD 0.013
Further Details:      
 
Domain Number 3 Region: 1666-1730
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.99e-18
Family PHD domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011547   Gene: ENSPANG00000021120   Transcript: ENSPANT00000017548
Sequence length 1907
Comment pep:known_by_projection chromosome:PapAnu2.0:11:52193578:52228091:-1 gene:ENSPANG00000021120 transcript:ENSPANT00000017548 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEANDHFNFTGLPPAPAASGLKPSPSSGEGLYTNGSPMNFPQQGKSLNGDVNVNGLSTVS
HTTTSGILNSAPHSSSTSHLHHPSVAYDCLWNYSQYPSANSGSNLKDPPLLSQFSGGQYP
LNGILGGSRQPSSPSHNTNLRAGSQEFWANGTQSPMGLNFDSQELYDSFPDQNFEVMPNG
PPSFFTSPQTSPMLGSSIQTFAPSQEVGSDIHPDEAAEKEMTSVVAENGTGLVGSLELEE
EQPELKMCGYNGSVPSVESLHQEVSVLVPDPTVSCLDDPSHLPDQLEDTPILSEDSLEPF
NSLAPEPVSGGLYGIDDTELMGAEDKLPLEDSPVISALDCPSLNNATAFSLLADDSQTSA
SIFASPTSPPVLGESVLQDNSFDLNNGSDTEQEEMETQSSDFPPSLTQPAPDQSSTIQLH
PATSPAVSPTTSPAVSLVVSPAASPEISPEVCPAASTVVSPAVFSVVSPASSAVLPAVSS
EVPLTASVTSPKASPVTSPTAAFPTASPANKDASSFLETTADLEEITGEELTTSSSGDVM
RRRIATPEEVRLPLQHGWRREVRIKKGSHRWQGETWYYGPCGKRMKQFPEVIKYLSRNVV
HSVRREHFSFSPRMPVGDFFEERDTPEGLQWVQLSAEEIPSRIQAITGKRGRPRNTEKTK
TKEVPKVKRGRGRPPKVKITELLDKTDNRLLKKLEAQETSNEEDKAKIGKSKKKMRQKVQ
RGECQTTIQGQARNKRKQETKSLKQKEAKKKSKAEKEKGKTKQEKLKEKVKREKKEKVKM
KEKEEVAKAKPACKADKTLATQRRLEERQRQQMILEEMKKPTEDMCLTDHQPLPDFSRVP
GLTLPSGAFSDCLTIVEFLHSFGKVLGFDPAKDVPSLGVLQEGLLCQGDSLGEVQDLLVR
LLKAALHDPGLPSYCQSLKILGEKVSEIPLTRDNVSEILRCFLMAYGVEPALCDRLRTQP
FQAQSPQQKAAVLAFLVHELNGSTLIINEIDKTLESMSSYRKNKWIVEGRLRRLKTVLAK
RTGRSEVEMEGPEECLGRRRSSRIMEETSGMEEEEEEESTAAVHGRRGRRDGEVDATASS
IPELERQIEKLSKRQLFFRKKLLHSSQMLRAVSLGQDRYRRRYWVLPYLAGIFVEGTEGN
LVPKDVIKKETDSLKVAAHTSLNPALFSMKMELAGSNTTASSPARARGRPRKTKPGSMQP
RHLKSPVRGQDSEQPQAQLQPEAQLHAPAQPQPQLQLQFQSHPQSHKGFLEQEGSPLSLG
QSQHDLSQSAFLSWLSQTQSHSSLLSSSVLTPDSSPGKLDPAPSQPPEEPEPDEAESSPD
PQALWFNISAQMPCNAAPTPPPAVSEDQPTPSPQQLASSKPMNRPSAANPCSPVQFSSTP
LAGLAPKRRAGDPGEMPQSPTGLGQPKRRGRPPSKFFKQMEQRYLTQLTAQPVPPEMCSG
WWWIRDPETLDAMLKALHPRGIREKALHKHLNKHRDFLQEVCLRPSADPIFEPRQLPVFQ
EGMMSWSPKEKTYETDLAVLQWVEDLEQRVIMSDLQIRGWTCPSPDSTREDLAYCEHLSS
SQEDITWRGRGREGLAPQRKTTNPLDLAVMRLAALEQNVERRYLREPLWPTHEVVLEKAL
LSTPNGAPEGTTTEISYEITPRIRVWRQTLERCRSAAQVCLCLGQLERSIAWEKSVNKVT
CLVCRKGDNDEFLLLCDGCDRGCHIYCHRPKMEAVPEGDWFCTVCLAQQVEGEFTQKPGF
PKRGQKRKSAYSLNFSEGDGRRRRVLLRGRESPAAGPRYSEEGQSPSKRRRLSMRNHHSD
LTFCEIILMEMESHDAAWPFLEPVNPRLVSGYRRIIKNPMDFSTMRERLLRGGYTSSEEF
AADALLVFDNCQTFNEDDSEVGKAGHIMRRFFESRWEEFYQGKQANL
Download sequence
Identical sequences ENSPANP00000011547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]