SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011560 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011560
Domain Number 1 Region: 545-590
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000889
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 2 Region: 123-156
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000119
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 63-112
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000301
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011560
Domain Number - Region: 499-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0711
Family EGF-type module 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011560   Gene: ENSPANG00000024233   Transcript: ENSPANT00000022892
Sequence length 591
Comment pep:known_by_projection chromosome:PapAnu2.0:1:59099582:59136917:-1 gene:ENSPANG00000024233 transcript:ENSPANT00000022892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNSRTSAWRALVELFLLCAALGCLSLPGSRGERLHSFESNAVNKSFAKSRQMRNVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLRPSQFHGEPCNFSDKEVEDCVTNRPCRSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
VFTNSLEGSVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFSLKEYESYSDF
EHNVIEKAASSSGFSFGFKIPGIFELGISRQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVKLGVSIGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKIKVEPLYELVTATDFA
YSSTVKQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPIGSQGLACEVSYRK
NIPTDGKWNCWSSWSSCSGGRKTRQRQCNNPPPQNGGSPCSGPASETLDCS
Download sequence
Identical sequences A0A096NF67
ENSPANP00000011560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]