SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011572 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011572
Domain Number 1 Region: 39-408
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.48e-61
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000261
Further Details:      
 
Domain Number 2 Region: 385-501
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 6.87e-44
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011572   Gene: ENSPANG00000025127   Transcript: ENSPANT00000010839
Sequence length 509
Comment pep:known_by_projection chromosome:PapAnu2.0:3:130046402:130075924:1 gene:ENSPANG00000025127 transcript:ENSPANT00000010839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSWSRVYCSLAKRGHFNRISHGLQGLSAVPLRTYADQPIDADVTVIGSGPGGYVAAIKA
AQLGFKTVCVEKNETLGGTCLNVGCIPSKALLNNSHYYHMAHGKDFASRGIEMSEVRLNL
DKMMEQKSTAVKALTGGIAHLFKQNKVIHVNGYGKITGKNQVTATKVDGGTQVVDTKNIL
IATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVT
AVEFLGHVGGVGIDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIDVSIEAASGGK
AEVITCDVLLVCIGRRPFTKNLGLEELGIELDPRGRIPVNTRFQTKIPNIYAIGDVVAGP
MLAHKAEDEGIICVEGMAGGAVHIDYNCVPSVIYTHPEVAWVGKSEEQLKEEGIEYKVGK
FPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDI
ARVCHAHPTLSEAFREANLAASFGKSINF
Download sequence
Identical sequences A0A2K5Y880
XP_011841753.1.47321 ENSPANP00000011572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]