SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011573 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011573
Domain Number 1 Region: 521-554,636-710
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000608
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011573   Gene: ENSPANG00000021181   Transcript: ENSPANT00000016706
Sequence length 733
Comment pep:known_by_projection chromosome:PapAnu2.0:3:129934649:129967063:-1 gene:ENSPANG00000021181 transcript:ENSPANT00000016706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIEPFGNQYIVARPVYSTNAFEENHKKRDRHHKTFLDHLRVCFSCSPQKAKRIVLSLFPI
ASWLPAYRLKEWLLSDIVSGISTGIVSVLQGLAFALLVTIPPGYGLYAAFFSTIIYLFFG
TSKHISAGPFPILSMMVGAATVRLAQNFPGNTGSSNNSTSNSSSLDDYKVTVAASVTVLS
GVIQLALGFLRIGFVVIYLSESLISGFTTAAAVHVLVSQLKFIFQLTVPSHEDPCSIFKV
LYSVFSQIEKTNIADLVTALIVLLVVSIFKEINQRFKDKLPVPIPIEFIVTVIATGVSYG
FDFQTRFNVSVVGKMNPGFEPPTAPDVAVFQETIGDCFAIAMVGFAVAFSVASVYSLKHD
YPLDGNQELIALGLGNIVCGAFRGFAGSTALSRSAVQESTGGKTQIAGLISAIIVLIVIL
AIGFLLEPLQRSVLAALALGNLKGMLMQFAEICRLWRKDKYDCLIWVTTCIFTIVLGLGL
GLAASVAFQLLTIVFRTQFPKCSTLANIGRSNIYKNKKDYYDMYELKGVKIFRCPSPIYF
ANIGFFRQKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIKDSDE
ELDNNQIQVLDEPIDTTDLPFQIDWNDQLPLNIEVPKISLHSLILDFSAVSFLDVSSMRG
LKSILQEFIRIKVDVYIVGVDDDFIEKLNRYEFFDGEVKTSILFLTIHDAVLHISMKKDY
STSKFKPSQVPAL
Download sequence
Identical sequences ENSPANP00000011573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]