SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011606 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011606
Domain Number 1 Region: 129-376
Classification Level Classification E-value
Superfamily vWA-like 3e-72
Family Integrin A (or I) domain 0.000000111
Further Details:      
 
Domain Number 2 Region: 374-461
Classification Level Classification E-value
Superfamily Integrin domains 3.98e-23
Family Integrin domains 0.0004
Further Details:      
 
Domain Number 3 Region: 625-709
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.7e-16
Family Integrin beta tail domain 0.001
Further Details:      
 
Domain Number 4 Region: 21-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000068
Family Plexin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 583-623
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000335
Family Integrin beta EGF-like domains 0.0016
Further Details:      
 
Domain Number 6 Region: 541-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011606
Domain Number - Region: 508-541
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011606   Gene: ENSPANG00000018923   Transcript: ENSPANT00000001623
Sequence length 792
Comment pep:known_by_projection chromosome:PapAnu2.0:12:21949299:22039151:-1 gene:ENSPANG00000018923 transcript:ENSPANT00000001623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQEKFTRPSGVGERCD
TPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQT
LQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLVFNCTKLK
ISSPIKHFTHEFLYGPTYFCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANID
TPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVIPNDGLCHLDS
KNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDS
GNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTFFQHQKKCSHMKVGDTASF
NVTVNIPNCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCG
VCACHPGHMGPRCECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYC
QCDNFSCVRHKGLLCGDNGDCDCGECVCRSGWTGEYCNCTTSTDSCVSEDGILCSGRGDC
VCGKCVCANPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATIS
EEEDFSKDGSVSCSLQGENECLITFLITTDNEGKSIIHSISEKADCPKPPNIPMIMLGVS
LAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFKNVTYKH
REKQKVDLSTDG
Download sequence
Identical sequences ENSPANP00000011606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]