SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011618 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011618
Domain Number 1 Region: 644-707
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000715
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 24-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 141-173
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 564-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000288
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 5 Region: 699-755
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000594
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 6 Region: 80-128
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000157
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011618   Gene: ENSPANG00000008845   Transcript: ENSPANT00000015523
Sequence length 936
Comment pep:known_by_projection chromosome:PapAnu2.0:6:40622955:40700987:-1 gene:ENSPANG00000008845 transcript:ENSPANT00000015523 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARHSILYFILLSALINKGQACFCDHYPWSQWSSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQSCPINCLLGDFGPWSDCDPCVEKQSKVRSVLRPSQFGGQPCTEP
LVVFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
ARKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVETAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFRVPIFYSSKRSENINQNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTMKAKDLYLSDVFLKALNNLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEETKHCVRIETKKRVLFVKKTKVEHRC
TTNKLSEKHEGSFLQGAEKSISLIRGGRSEYAAALAWEKGSSGLEEKTFSDWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRNNLRKAFQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCERRSPDYKSNAVDGHWGCWSSWSTCDATYKRSRTRECNNPAPERGRKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVNLPEIEADSGCPQPVPPENGFIRNEKK
LYSVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEILTITPFQR
LYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKVSDSLTKLKGHCQLGQK
QSGSECICMSPEEDCSHYSEDLCVFDTDSNDYFTSPACQFLAEKCLNNQQLHFLHIGSCQ
DGRQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCTASTSKCVCLLPPQCFKGGNQLYCV
KMGSSTSEKTLNICEVGAIRCANRKVEILHPGKCLA
Download sequence
Identical sequences ENSPANP00000011618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]