SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011645 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011645
Domain Number 1 Region: 885-1007
Classification Level Classification E-value
Superfamily Bromodomain 3.92e-34
Family Bromodomain 0.00035
Further Details:      
 
Domain Number 2 Region: 215-277
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.49e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 
Domain Number 3 Region: 820-876
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.86e-16
Family PHD domain 0.0035
Further Details:      
 
Domain Number 4 Region: 55-82
Classification Level Classification E-value
Superfamily RING/U-box 0.00000303
Family RING finger domain, C3HC4 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011645   Gene: ENSPANG00000007105   Transcript: ENSPANT00000020250
Sequence length 1050
Comment pep:known_by_projection chromosome:PapAnu2.0:3:160247914:160374556:1 gene:ENSPANG00000007105 transcript:ENSPANT00000020250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAVEKAAAAAAAASAAASGGPSAAPSGENEAESRQGPDSERGGEAARLNLLDTCAVCH
QNIQSRAPKLLPCLHSFCQRCLPAPQRYLMLPAPMLGSAETPPPVPAPGSPVSGSSPFAT
QVGVIRCPVCSQECAERHIIDNFFVKDTTEVPSSTVEKSNQVCTSCEDNAEANGFCVECV
EWLCKTCIRAHQRVKFTKDHTVRQKEEVSPEAVGVTSQRPVFCPFHKKEQLKLYCETCDK
LTCRDCQLLEHKEHRYQFIEEAFQNQKVIIDTLITKLMEKTKYIKFTGNQIQNRIIEVNQ
NQKQVEQDIKVAIFTLMVEINKKGKALLHQLENLAKDHRMKLMQQQQEVAGLSKQLEHVM
HFSKWAVSSGSSTALLYSKRLITYRLRHLLRARCDASPVTNNTIQFHCDPSFWAQNIINL
GSLVIEDKESQPQMPKQNPVVEQNSQPPSGLSSNQLSKFPTQISLAQLRLQHMQQQVMAQ
RQQVQRRPAPVGLPNPRMQGPIQQPSISHQQPPPRLINFQNHSPKPNGPVLPPHPQQLRY
PPNQNIPRQAIKPNPLQMAFLAQQAIKQWQISSGQGTPSTTNSTSSTPSSPTITSAAGYD
GKAFGSPMIDLSSPVGGSYNLPSLPDIDCSSTIMLDNIVRKDTNIDHGQPRPPSNRTVQS
PNSSVPSPGLAGPVTMTSVHPPIRSPSASSVGSRGSSGSSSKPAGADSTHKVPVVMLEPI
RIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRS
DAPDSTGDQPGLHQENSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLC
CEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHISEKKKTEGLVKL
TPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYS
KPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESE
DNKFSDDSDDDFVQPRKKRLKSIEERQLLK
Download sequence
Identical sequences A0A096NFE9
ENSPANP00000011645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]