SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011670 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011670
Domain Number 1 Region: 541-787,828-941
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 5.23e-132
Family Oxysterol-binding protein 0.00035
Further Details:      
 
Domain Number 2 Region: 9-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.85e-42
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 236-344
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000516
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011670   Gene: ENSPANG00000006624   Transcript: ENSPANT00000002733
Sequence length 949
Comment pep:known_by_projection chromosome:PapAnu2.0:18:16253064:16479418:-1 gene:ENSPANG00000006624 transcript:ENSPANT00000002733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTEAEQQLLHHARNGNAKEVRQLLETMARNEVIADINCKGRSKSNLGWTPLHLACYFGH
RQVVQDLLKAGAEVNVLNDMGDTPLHRAAFTGRKELVMLLLEYNADTTVVNGSGQTAKEV
THAEEIRSMLEAVERTQQRKLEELLLAAAREGKTTELTALLNRPNPPDVNCSDQLGNTPL
HCAAYRAHKQCALKLLRSGADPNLKNKNDQKPLDLAQGAEMKHILVNKVIYKALKRYEGP
LWKSSRFFGWRLFWVVLEHGVLSWYRKQPDAVHNIYRQGCKHLTQAVCTVKSTDSCLFFI
KCFDDTIHGFRVPKNSLQQSREDWLEAIEEHSAYSTHYCSQDQLTDEEEEDMVSAVDLKK
SLEKAQSCQQRLDREISNFLKMIKECDMAKEMLPSFLQKVEVVSEASRETCVALSDCLNL
FTKQERVKNFKLEQEQEKNKILSEALETLATEHHELEQSLVKGSPPTSILSEDEFYDALS
DSESERSLSRLEAVTAHSFEEEGEHLGSRRHRMSEEKDCGGGDALSNGIKKHRTSLPSPM
FSRNDFSIWSILRKCIGMELSKITMPVIFNEPLSFLQRLTEYMEHTYLIHKASSLSDPVE
RMQCVAAFAVSAVASQWERTGKPFNPLLGETYELVRDDLGFRLISEQVSHHPPISAFHAE
GLNNDFIFHGSIYPKLKFWGKSVEAEPKGTITLELLEHNEAYTWTNPTCCVHNIIVGKLW
IEQYGNVEIINHKTGDKCVLNFKPCGLFGKELHKVEGYIQDKSKKKLCALYGKWTECLYS
VDPATFDAYKKNDKKNTEEKKNSKQMSTSEESDEMPMPDSESVFIIPGSVLLWRIAPRPP
NSAQMYNFTSFAMVLNEVDKDMESVIPKTDCRLRPDIRAMENGEIDQASEEKKRLEEKQR
AARKNRSKSEEDWKTRWFHQGPNPYNGAQDWIYSGSYWDRNYFNLPDIY
Download sequence
Identical sequences A0A096NFH2
ENSPANP00000011670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]