SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011677 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011677
Domain Number 1 Region: 644-693
Classification Level Classification E-value
Superfamily EF-hand 0.0000164
Family Calmodulin-like 0.05
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011677
Domain Number - Region: 546-671
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0157
Family HBL-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011677   Gene: ENSPANG00000024554   Transcript: ENSPANT00000009748
Sequence length 739
Comment pep:known_by_projection chromosome:PapAnu2.0:1:2182409:2224075:1 gene:ENSPANG00000024554 transcript:ENSPANT00000009748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASILLRSCRGRAPARLPPPSRVTAPRGSLGDPAHLSCANTLGLRSCLNVPFGCCTSIHP
VYPSFRGDHLGCWTLRPECLRTVLGAPWTSTSVGFVVVGPRCLPVRGWHSSRPVGDDSVV
EKSLKSLKDKNKKLEEGGPVYSPPAEVVVKKSLGQRVLDELKHYYHGFRLLWIDTKIAAR
MLWRILNGHTLTRRERRQFLRICADLFRLVPFLVFVVVPFMEFLLPVAVKLFPNMLPSTF
ETQSIKEERLKKELRVKLELAKFLQDTIEEMALKNKAAKGSATKDFSVFFQKIRETGERP
SNEEIMRFSKLFEDELTLDNLTRPQLVALCKLLELQSIGTNNFLRFQLTMRLRSIKADDK
LIAEEGVDSLNVKELQAACRARGMRALGVTEDRLRGQLKQWLDLHLHQEIPTSLLILSRA
MYLPDTLSPADQLKSTLQTLPEIVAKEAQVKAAEVEGEQVDNKAKLEATLQEEAAIQQEH
REKELQKLSEAAKDVEPERVVAVPQRLGAELQPEVSDTVLRSETLKDTAPVLGGLKEEQI
TKEEIDILSDACSKLQEQKKSLTKEKEELELLKEDMQDYSEDLQEIKKELSKTGEEKYVE
ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPASGMPTGENVISVAELISAMKQV
KHIPESKLTSLAAALDENKDGKVNIDDLVKVIELVDKEDVHISTSQVAEIVATLEKEEKV
EEKEKAKEKAEKEVAEVKS
Download sequence
Identical sequences A0A096NFH9
ENSPANP00000011677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]