SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011699 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011699
Domain Number 1 Region: 124-274
Classification Level Classification E-value
Superfamily EF-hand 1.01e-39
Family Calmodulin-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011699   Gene: ENSPANG00000011704   Transcript: ENSPANT00000009515
Sequence length 275
Comment pep:known_by_projection chromosome:PapAnu2.0:14:6631534:6634756:-1 gene:ENSPANG00000011704 transcript:ENSPANT00000009515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATEQARGQHGPDPATGPQKPPAGVVTPKSDAEEPPLTRKRSNKERGLRGSRKRTGSSGE
QSGPEAPGSSNNPPRTGEGPVGAPPASPGPASSRQSHRHRPDSRHDAAQRTYGPLLNRVF
GKDRELGPEELDELQAAFEEFDTDHDGYISHRELGDCMRTLGYMPTEMELLEVSQHIKMR
MGGRVDFEEFVELIGPKLREETAHMLGVRELRIAFREFDRDRDGRITVAELREAVPALLG
EPLAGPELDEMLREVDLNGDGTVDFDEFVMMLSRH
Download sequence
Identical sequences A0A096NFJ8
ENSPANP00000011699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]