SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011730 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011730
Domain Number 1 Region: 1504-1768
Classification Level Classification E-value
Superfamily Kelch motif 4.71e-40
Family Kelch motif 0.016
Further Details:      
 
Domain Number 2 Region: 211-498
Classification Level Classification E-value
Superfamily Kelch motif 9.02e-38
Family Kelch motif 0.0044
Further Details:      
 
Domain Number 3 Region: 36-142
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-24
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 4 Region: 1211-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 5 Region: 1074-1109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000002
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 6 Region: 1163-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000389
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000011730
Domain Number - Region: 2197-2247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000151
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 2125-2160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 2291-2326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family Laminin-type module 0.025
Further Details:      
 
Domain Number - Region: 1298-1401
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00837
Family Spermadhesin, CUB domain 0.0086
Further Details:      
 
Domain Number - Region: 509-536
Classification Level Classification E-value
Superfamily Kelch motif 0.034
Family Kelch motif 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011730   Gene: ENSPANG00000013862   Transcript: ENSPANT00000019170
Sequence length 2789
Comment pep:known_by_projection chromosome:PapAnu2.0:19:36530284:36580937:1 gene:ENSPANG00000013862 transcript:ENSPANT00000019170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGKALATALALALAVLGSLSPGAQAGDCKGQRQVLREAPGFVTDGAGNYSVNGNCEWL
IEAPSPQHRILLDFLFLDTECTYDYLFVYDGDSPRGPLLASLSGSTRPPPIEASSGKMLL
HLFSDANYNLLGFNASFRFSLCPGGCRSHGQCQPPGVCACEPGWGGPDCGVQECSAYCGS
HGTCASPLGPCRCEPGFLGRACDLHLWENQGAGWWHNVSAGDPAFSARIGAAGAFLSPPG
LLAVFGGQDLNNALGDLVLYNFSANTWESWDLSPAPAARHSHVAVAWAGSLVLMGGELAD
GSLINDVWAFSPLGRGHWELLAPPASSSSGPPGLAGHAAALVDDVWLYVSGGRTQHDLFS
SGLFRFRLDSTSGGYWEQVIPAGGRPPAATGHSMVFHAPSRALLVHGGHRPSTARFSVRV
NSTELFHVDRRVWTTLKGRDGLQGPRERAFHTASVLGNYMVVYGGNVHTHYQEEKCYEDG
IFFYHLGCHQWVSGAELAPPGTPEGRAAPPSGRYSHVAAVLGGSVLLVAGGYSGRPRGDL
MAYKVPPFVFQAPAPDYHLDYCSMYTDHSVCSRDPECSWCQGACQAAPPPGTPLGACPAA
SCLGLGRLLGDCQACLAFSSPTAPPWGPGTLGWCVHNESCLPRPEQARCRGEQISGTVGW
WGPAPVFVTSLEACVTQSFLPGLHLLTFQQPPNTSQPDKVSIVRSTTITLTPSAETDVSL
VYRGFIYPMLPGGPGGPGSEDVAVWARAQRLHVLARMARGPDTENMEEVGRWVAHQEKET
RQLQRPGSARLFPLPGRDHKYAVEIRGQLNGSAGPGHSELTLLWDRTGVPGGSEISFFFL
EPYRSSACTSYSSCLGCLADQGCGWCLTSASCHLRQGGAHCGDDRAGGSLLVLVPTLCPL
CEEHRDCHACTQDPFCEWHQSTSRKGDAACSRRGRGRGAIKSPEECPPLCNQRLTCEDCL
ANSSQCAWCQSTHTCFLFAAYLARYPHGGCRGWDDSVHSEPRCRSCDGFLTCHECLQSHE
CGWCGNEDNPTLGRCLQGDFSGPLGGGNCSLWVGEGLGLPVALPARWAYARCPDVDECRL
GLARCHPRATCLNTPLSYECHCQRGYQGDGISHCNRTCLEDCGHGVCSGPPDFTCVCDLG
WTSDLPLPTPAPGPPAPRCSRDCGCSFHSHCRKRGPGFCDECQDWTWGEHCERCRPGSFG
NATGSRGCRPCQCNGHGDPRRGHCDNLSGLCFCQDHTEGAHCQLCSPGYYGDPRAGGSCF
RECGGRALLTNVSSVALGSRRVGGLLPPGGGAARAGPGLSYCVWVVSATEELQPCAPGTL
CPPLTLTFSPDSSTPCTLSYVLAFDGFPRFLDTGVVQSDRSLIAAFCGQRRDRPLTVQAL
SGLLVLHWEANGSSSWGFNASVGSARCGSGGPGSCPVPQECVPQDGAAGAGLCRCPQGWA
GPHCRMALCPENCNAHTGAGTCNQSLGVCICAEGFGGPDCATKLDGGQLVWETLMDSRLS
ADTASRFLHRLGHTMVEGPDATLWMFGGLGLPQGLLGNLYRYSVSERRWTQMLAGAEDGG
PGPSPRSFHAAAYVPAGRGAMYLLGGLTAGGVTRDFWVLNLTTLQWRQEKAPQTVELPAV
AGHTLTARRGLSLLLVGGYSPENGFNQQLLEYQLATGTWVSGAQSGTPPTGLYGHSAVYH
EATDSLYVFGGFRFHVELAAPSPELYSLHCPDRTWSLLAPSQGAKPRPRLFHASALLGDT
MVVLGGRSDPDEFSSDVLLYQVNCNAWLLPDLTRPASVGPPVEESVAHAVAAVGGRLYIS
GGFGGVALGRLLALTLPPDPCRLLSSPEACNQSGACTWCHGACLSGDQAHRLGCGGSPCS
PMPRSPEECRRLRTCSECLARHPRTLQPGDGEASAPRCKWCTNCPEGACIGRNGSCTSEN
DCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTC
FSHSLLNVSPMPVESSPPLPCPTPCHLLPNCTSCLDSKGADGGWQHCVWSSSLQQCLSPS
YLPLRCMAGGCGRLLRGPESCSLGCAQATQCASCLRRPHCGWCAWRGQDGGGRCMEGGLS
GPRDGLTCGRPGASWAFLSCPPEDECANGHHDCNETQNCHDQPHGYECSCKTGYTMDNVT
GLCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDHCLLCRNH
TKGSHCEQCLPLFVGSAVGGGTCRPCHTFCRGNSHVCISKKEFEMAKGEPQKYSLDPEEI
ENWVTEGPSEDEAMCVNCQNNSYGEKCESCLQGYFLLDGKCTKCQCNGHADTCNEQDGTG
CPCQNNTETGTCQGSSPSDRRDCYKDQCAKCRESFHGNPLGGQQCYRLISVEQECCLDPT
SQTNCFHEPKRRALGPGRTVLFGVQPKFTNVDIRLTLDVTFGAVDLYVSTSYDTFVVRVA
PDTGVHTVHIQASQPPPPPPPLADGGPRGAGDPGGAGASSGPGAPAEPRVREVWPQGLIT
YVTVTEPSAVLVVHSVRDRLVITYPHEHHALKSSRFYLLLLGVGDPSGPGANGSADSQGL
LFFRQDQAHIDLFVFFSVFFSCFFLFLSLCVLLWKAKQALDQRQEQRRHLQEMTKMASRP
FAKVTVCFPPDPTALAPAWKPAGLPPPAFRRSEPFLAPLLLTGASGPWGPMGGGCCPPAI
PATTAGLRAGPITLEPTEDGMAGVATLLLQLPGGPHAPNGACLGSALVTLRHRLHEYCGG
GGVAGGSGHGAGVGRKGLLSQDNLTSMSL
Download sequence
Identical sequences A0A0A0MX68
ENSPANP00000011730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]