SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011759 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011759
Domain Number 1 Region: 13-342
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.03e-110
Family Calpain large subunit, catalytic domain (domain II) 0.000000331
Further Details:      
 
Domain Number 2 Region: 492-667
Classification Level Classification E-value
Superfamily EF-hand 7.56e-21
Family Penta-EF-hand proteins 0.00025
Further Details:      
 
Domain Number 3 Region: 347-482
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 9.42e-20
Family Calpain large subunit, middle domain (domain III) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011759   Gene: ENSPANG00000015857   Transcript: ENSPANT00000027436
Sequence length 669
Comment pep:known_by_projection chromosome:PapAnu2.0:13:29791680:29867744:-1 gene:ENSPANG00000015857 transcript:ENSPANT00000027436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYNQESSVETSIIKFKDQDFTTLRDYCLSMGQTFKDETFPAADSSIGQKLLQEKRLSNV
IWKRPQDLPGGPPHFILDGISRFDIQQGGAADCWFLAALGSLTQNPQYRQKILRVQSFSH
QYAGIFRFRFWQCGQWVEVVIDDRLPVQGDKCLFVRPRHKNQEFWPCLLEKAYAKLLGSY
SDLHYGFLEDALVDLTGGVITNIHLHSSPVDLVKAVKTAIKAGSLITCATPSESTDTAQA
MENGLVSLHAYTVTGAEQIQYRRGWEEIISLWNPWGWGETEWRGRWSDGSQEWEETRDPR
KSQLHKKQEDGEFWMSCQDFQQKFVSMFICSQIPITLDHGNTLHEGWSQIMFRKQVILGN
TTGGLRNDAQFNFSVQEPMEGTNVVICITIAITPPNLKAEDEKLPLNFQVIPAGSQRFQE
KFPPVFSSPFGNVVQSSNNKFRRNFTVTYHLSPGNYVVVAQTRRKSVEFLLRIFLKTPDN
DRHLSHHFNLRMEGSPSEHGSQQSIFNRYAQQRLDIDATQLHSLLNQELLTGPPGDMFSL
DECRSLVALMELKVDGRLDQEEFARLWKRLVHCQHVFQKVQTSPGVLLSSDLWKAIENTD
FLRGIFVSRELLRLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEM
EWMNLVMYN
Download sequence
Identical sequences A0A096NFQ7
ENSPANP00000011759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]