SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011769 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011769
Domain Number 1 Region: 121-632
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.01e-158
Family Calponin-homology domain, CH-domain 0.0000000029
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily EF-hand 4.94e-17
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011769   Gene: ENSPANG00000018366   Transcript: ENSPANT00000025427
Sequence length 639
Comment pep:known_by_projection chromosome:PapAnu2.0:X:104437019:104477585:1 gene:ENSPANG00000018366 transcript:ENSPANT00000025427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKL
MLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHS
YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDE
RAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLF
ADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKLID
FSNSVKDSKAYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQ
FVTPADVVSGNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLG
VNPHVNHLYADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGK
HPAKFSLVGIGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRT
LSEAGKSTSIQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVS
MARRIGARVYALPEDLVEVKPKMVMTVFACLMGRGMKRV
Download sequence
Identical sequences A0A096NFR7 A0A2I3T4I1 A0A2K5ERR0 A0A2K5UVB1 A0A2K6CEW6 K7EUS3 U3F7A0
ENSPANP00000011769 ENSPPYP00000024300 ENSPPYP00000024300 XP_011754534.1.29376 XP_011812920.1.43180 XP_011839847.1.47321 XP_011839852.1.47321 XP_012307211.1.9421 XP_012354412.1.23891 XP_014983480.1.72884 XP_014983481.1.72884 XP_014983482.1.72884 XP_014983483.1.72884 XP_014983484.1.72884 XP_016798853.1.37143 XP_016798854.1.37143 XP_017823911.1.60252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]