SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011782 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000011782
Domain Number - Region: 37-118
Classification Level Classification E-value
Superfamily PH domain-like 0.0984
Family Pleckstrin-homology domain (PH domain) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011782   Gene: ENSPANG00000001194   Transcript: ENSPANT00000001124
Sequence length 161
Comment pep:known_by_projection chromosome:PapAnu2.0:11:12874444:12892584:1 gene:ENSPANG00000001194 transcript:ENSPANT00000001124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVLLAGIFVVHIATVIMLFVCTIANVWVVSNAGNASVGLWNNCTNTLCNGTLVYAHEDA
LKTVQAFMILSIIFSAISLLVFVFQLFTMEKGNRFFLSGATMLVCWLCVLVGVSIYTSHY
ANGYITYYGSDDHHGYSYILAWICFCFSFIIGVLYLVLRKK
Download sequence
Identical sequences A0A096NFS8
ENSPANP00000011782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]