SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011785 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011785
Domain Number 1 Region: 296-389
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000000341
Family Glutathione S-transferase (GST), C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011785   Gene: ENSPANG00000004960   Transcript: ENSPANT00000007459
Sequence length 466
Comment pep:known_by_projection chromosome:PapAnu2.0:1:129034967:129039892:1 gene:ENSPANG00000004960 transcript:ENSPANT00000007459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLGGPPRSPRSGTSPKGPRSSTGHVQFGKSPQTWPRRTRPRSPEPAAPSGARGFTQPRR
RDSLKRAGRTALSRYVGHLWMGRRPPSPEARGPVPRSSAASRTRRSLASPGTSPGPLTAT
TGGAVVGGGSVQGRAGAHKEVFPGQRAGKMAAPMELFCWSGGWGLPSVDLDSLAVLTYAR
FTGAPLKVHKISNPWRSPSGTLPALRTSHGEVISVPHKIITHLRKEKYNADYDLSARQGA
DTLAFMSLLEEKLLPVLVHTFWIDTKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQYMERL
ELLSGEHMPEDEEELEKELYREARECLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLL
QAKLPSGKLQAHLRGLHNLCAYCTHILSLYFPWDGAEVPPPRQTPAGPETEEEPYRRRNQ
ILSVLAGLAAMVGYALLSGIVSIQRATPARAPGTRALGMAEEDEEE
Download sequence
Identical sequences ENSPANP00000011785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]