SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011791 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011791
Domain Number 1 Region: 918-1109
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00081
Further Details:      
 
Domain Number 2 Region: 63-97
Classification Level Classification E-value
Superfamily WW domain 0.000000122
Family WW domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011791   Gene: ENSPANG00000010062   Transcript: ENSPANT00000012043
Sequence length 1114
Comment pep:known_by_projection chromosome:PapAnu2.0:8:139102706:139246752:-1 gene:ENSPANG00000010062 transcript:ENSPANT00000012043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTQDYECRSHNVDLPESRIPGSSTRLEWVEIIEPRTRERMYANLVTGECVWDPPAGVR
IKRTSENQWWELFDPNTSRFYYYNASTQRTVWHRPQGCDIIPLAKLQTLKQNTESPRASA
ESSPGRGSSVSREGSTSSSLEPEPDTEKAQELPARTGRPAAFGALKEDSGSSSPPGVFLE
KDYEIYRDYSADGQLLHYRTSSLRWNLGAKERMLIKVADREPSFLAAQGNGYAPDGPPGV
RSRRPSGSQHSPSLQTFAPEADGTIFFPERRPSPFLKRAELPGSSSPLLAQPRKPSGDSQ
PSSPRYGYEPPLYEEPPVEYQAPIYDEPPMDVQFEAGGGYQAGSPQRSPGRKPRPFLQPN
KQGPPSPCQQLVLTKQKCPERFLSLEYSPAGKEYVRQLVYVEQAGSSPKLRAGPRHKYAP
NPGGGSYSLQPSPCLLRDQRLGVKSGDYSTMEGPELRHSQPPTPLPQAQEDAMSWSSQQD
TLSSTGYSPGTRKRKSRKPSLCQATSATPTEGPGDLLVEQPLAEEQPPCGTSLAPVKRAE
GEADGARGAAEPFLAQARLAWEAQQAHFHMKQRSSWDSQQDGSGYESDGALPLPMPGPVV
RAFSEDEALAQQENKHWRRGTFEKLGFPQILLEKSVSVQTNLASPEPYLHPSQSEDLGAC
AQFESSRQSRSGIPSASCVFPTFTLRKPSSETDIENWASKHFNKHTQGLFRRKVSIANML
AWSSESIKKPMIVTSDRHVKKEACELFKLIQMYMGDRRAKADPLHVALEVATKGWSVQGL
RDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTK
VTQHIKELLERNTKKKSKLRKKPKPYVEEPDGVAISTYAKYCYHKLQKAALTGAKKGLKK
PNVEEIRHAKNAVFSPSMFGSALQEVMGMQRERYPERQLPWVQTRLSEEVLALNGDQTEG
IFRVPGDIDEVNALKLQVDQWKVPTGLEDPHVPASLLKLWYRELEEPLIPHEFYEQCIAH
YDSPEAAVAVVHALPRINRMVLCYLIRFLQVFVQPANVAVTKMDVSNLAMVMAPNCLRCQ
SDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGVL
Download sequence
Identical sequences A0A096NFT7 A0A2K6BMJ3
XP_011710216.1.29376 XP_011710217.1.29376 XP_011710218.1.29376 ENSPANP00000011791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]