SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011793 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011793
Domain Number 1 Region: 119-238
Classification Level Classification E-value
Superfamily TIMP-like 1.54e-36
Family Netrin-like domain (NTR/C345C module) 0.00028
Further Details:      
 
Domain Number 2 Region: 15-90
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-18
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011793   Gene: ENSPANG00000005937   Transcript: ENSPANT00000017594
Sequence length 238
Comment pep:known_by_projection chromosome:PapAnu2.0:2:143277890:143299610:1 gene:ENSPANG00000005937 transcript:ENSPANT00000017594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLIFDTSIVLSLKLIELKFEKFDVERDNYCRYDYVAVFNGGEVNDAERIGKYCGDSPPA
PIVSERNELLIQFLSDLSLTADGFIGHYKFRPKKLPATTAQPVTTTFPVTTGLKPTVVLC
QQKCRRTGTLEGNYCSSDFVLAGTVITTATRGGSLHATVSIINIYKEGNLAIQQAGKNMS
ARLTVVCKQCPLLRRGLNYIIMGQVGEDGRGKIMPNSFIMMFKTKNQKLLNALKNKQC
Download sequence
Identical sequences ENSPANP00000011793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]