SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000011816 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000011816
Domain Number 1 Region: 348-482
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.05e-36
Family Synaptotagmin-like (S variant) 0.00083
Further Details:      
 
Domain Number 2 Region: 493-634
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.42e-33
Family Synaptotagmin-like (S variant) 0.0022
Further Details:      
 
Domain Number 3 Region: 8-129
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.64e-27
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000011816   Gene: ENSPANG00000014703   Transcript: ENSPANT00000022222
Sequence length 671
Comment pep:known_by_projection chromosome:PapAnu2.0:X:90506184:90531667:-1 gene:ENSPANG00000014703 transcript:ENSPANT00000022222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSELLDLSFLSEEEKDLILSVLQRDEEVRKADEKRIKRLKNELLEIKRKGAKRGSQHYSD
RTCARCQESLGRLSPKTNTCRGCNHLVCRDCRIQESNGTWRCKVCAKEIELKKATGDWFY
DQKVNRFAYRTGSELIRMSLRHKPAVSKRETVGQSLLHQTQMGDIWPGRKIIQERQREPS
VLFEVPKLKSGKSALEAESESLDSFTADSDSTSRRDSLDKSGLFPEWKKMSAPKSQVEKE
TQPGGQNVVFVDEGEMIFKKNTRKILRPSEYTKSVIDLRPEDVGHESGSLGDRSKSVPGL
NVDMEEEEEEEDIDHLVKLHRQKLARSSMQSGSSMSTIGSMMSIYSEAGDFGNIFVTGRI
AFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTI
NPLYDETLRYEIPESLLTQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPL
HGKISAESPTGLPSHKGELVVSLKYIPASKPPVGGDRKKSKGGEGGELQVWIKEAKNLTA
AKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELT
VWDREPLASNDFLGGVRLGVGTGNSNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQL
RSSMAKQKLGL
Download sequence
Identical sequences ENSPANP00000011816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]